KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22782Help
Entry
Dpse_GA22782      CDS       T01032                                 

Definition
GA22782 gene product from transcript GA22782-RA (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dpse_GA22782
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dpse_GA22782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 643 aa AA seqDB search
MPLHLNSQQGVCHQRRRHGHDPRQEPQQQKNKLQQVQSPPMELVMLLLLMLTLLTRPLSA
FSNRLSDTKLHEIYLDEKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGGLAD
ADICFFENQNGFFNAVTDTYTSPDGRWVRKDYQQDCEVFKMDEFTLAFKRKFDTCDPLDL
RLHEGTMYVVWARGESELSLEDHQFALPNVTSAHEAGVKMLQILRADKILIPEKDLDMVE
ITLSKAPIPSEETTYWCHVQRLDDFVKHRHHIVQFEPLIKNPGIVHHMEVFHCEGGEHEE
MPLYNGDCTNLPAKAKVCSKVMALWAMGASTFTYPPEAGLPIGGPGYNPYVRLEVHFNNP
EKQAGLIDNSGFRIKMSRTLRQFDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTKA
ALPATGIIIFGSQLHTHLRGVRVLTRHFRGDQELREVNRDDYYSNHFQEMRTLHYKPRVL
PGDALVTTCYYNTLNDTRTALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFI
YMKRTEHQRGIHLNGARSANYRSIEWSQPRVDQLYTMYIQEPLSMQCNTSDGGRFASQSW
EGVAPTAVQIKIPIHRKLCPNYNPLWLRPLEKGECDLLGECIY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcatctgaatagtcaacaaggcgtttgccatcagcgccgccgtcatggccat
gatcctcggcaggagccgcagcaacaaaagaataaactgcagcaggtacagtcgccgcca
atggagctagtgatgctgctcctcctgatgctgacgctcctaacgcggcccctgagcgcc
ttctcgaaccgcctgtcggacacgaagctgcacgagatctatctggacgagaaggagatc
aagctcagctggatggtggactggtacaagcaggaggtgctctttcacctgcaaaacgcc
ttcaacgagcagcaccgctggttctacctgggcttctcgaagcggggcggcctcgccgat
gcggacatttgcttcttcgagaatcagaacggcttcttcaatgcggtgaccgacacttac
accagtccggacgggcgctgggtgcgcaaggactaccagcaggactgtgaggtcttcaag
atggacgagttcacgctggccttcaagcggaagttcgacacttgcgatcccctcgatctg
cggctccacgagggcaccatgtatgtggtgtgggcgcggggcgaatccgagctttcgctg
gaggatcaccagttcgcgctgcccaatgtgacgtctgcccacgaggcgggcgtaaagatg
ctgcaaattctccgtgctgacaagatactcattcccgaaaaagatctggatatggtggag
atcaccctttcgaaggcccccatccccagcgaggagaccacctactggtgccacgtgcag
cgtctggacgacttcgtcaaacatcgccaccacattgttcagttcgagccgctgatcaag
aacccgggcattgtacaccacatggaggtgttccactgcgagggcggggagcacgaggag
atgcctctgtacaacggcgactgcacaaatttgccggccaaggccaaggtctgctcgaag
gtgatggccctctgggccatgggcgccagcacattcacctatccgccagaggccggcctg
cccattggcggccccggttacaatccctatgtccggctcgaggttcacttcaataatccc
gagaaacaggctggcctcattgacaactccggctttcgcatcaagatgtcgaggactttg
cgacagttcgacgcagccgtcatggagctgggcctggagtatacggacaagatggccata
ccgcccggtcaaacggccttcccattgagcggctactgcgtggcggactgcacgaaggct
gcactgccggcgaccggcatcatcatctttggatcgcagttgcacacgcacctgcgcggc
gtgcgggtacttacgcgccacttccgcggggaccaagagctgcgggaggtgaaccgagac
gactactactcgaatcacttccaggagatgcgcacgctgcactacaagcctcgtgtactg
cccggggatgctctggtgaccacttgctactacaacaccctaaacgacacgaggactgcc
ctggggggcttctccatcagtgacgagatgtgcgtcaactacatccactactacccggcc
accaagctggaggtctgcaagagctccgtgtcggaggagacgctcgagaactacttcatc
tacatgaagcggacggagcaccagcgcggcatccatttgaatggggcacgttcggcgaat
tatcggagcatcgagtggagccagccgcgcgtcgaccaactgtacacgatgtacatccag
gagccgcttagcatgcagtgcaacacatcggacggagggcgctttgcgagccagagctgg
gagggcgtggccccgacggccgtgcaaatcaaaatacccatccaccgcaaactctgtccc
aactataatccgttgtggttgaggccgctggagaagggtgaatgcgatttgcttggcgag
tgcatctactaa

DBGET integrated database retrieval system