KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22782Help
Entry
Dpse_GA22782      CDS       T01032                                 

Definition
GA22782 gene product from transcript GA22782-RA (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dpo00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 643 aa AA seqDB search
MPLHLNSQQGVCHQRRRHGHDPRQEPQQQKNKLQQVQSPPMELVMLLLLMLTLLTRPLSA
FSNRLSDTKLHEIYLDEKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGGLAD
ADICFFENQNGFFNAVTDTYTSPDGRWVRKDYQQDCEVFKMDEFTLAFKRKFDTCDPLDL
RLHEGTMYVVWARGESELSLEDHQFALPNVTSAHEAGVKMLQILRADKILIPEKDLDMVE
ITLSKAPIPSEETTYWCHVQRLDDFVKHRHHIVQFEPLIKNPGIVHHMEVFHCEGGEHEE
MPLYNGDCTNLPAKAKVCSKVMALWAMGASTFTYPPEAGLPIGGPGYNPYVRLEVHFNNP
EKQAGLIDNSGFRIKMSRTLRQFDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTKA
ALPATGIIIFGSQLHTHLRGVRVLTRHFRGDQELREVNRDDYYSNHFQEMRTLHYKPRVL
PGDALVTTCYYNTLNDTRTALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFI
YMKRTEHQRGIHLNGARSANYRSIEWSQPRVDQLYTMYIQEPLSMQCNTSDGGRFASQSW
EGVAPTAVQIKIPIHRKLCPNYNPLWLRPLEKGECDLLGECIY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcatctgaatagtcaacaaggcgtttgccatcagcgccgccgtcatggccat
gatcctcggcaggagccgcagcaacaaaagaataaactgcagcaggtacagtcgccgcca
atggagctagtgatgctgctcctcctgatgctgacgctcctaacgcggcccctgagcgcc
ttctcgaaccgcctgtcggacacgaagctgcacgagatctatctggacgagaaggagatc
aagctcagctggatggtggactggtacaagcaggaggtgctctttcacctgcaaaacgcc
ttcaacgagcagcaccgctggttctacctgggcttctcgaagcggggcggcctcgccgat
gcggacatttgcttcttcgagaatcagaacggcttcttcaatgcggtgaccgacacttac
accagtccggacgggcgctgggtgcgcaaggactaccagcaggactgtgaggtcttcaag
atggacgagttcacgctggccttcaagcggaagttcgacacttgcgatcccctcgatctg
cggctccacgagggcaccatgtatgtggtgtgggcgcggggcgaatccgagctttcgctg
gaggatcaccagttcgcgctgcccaatgtgacgtctgcccacgaggcgggcgtaaagatg
ctgcaaattctccgtgctgacaagatactcattcccgaaaaagatctggatatggtggag
atcaccctttcgaaggcccccatccccagcgaggagaccacctactggtgccacgtgcag
cgtctggacgacttcgtcaaacatcgccaccacattgttcagttcgagccgctgatcaag
aacccgggcattgtacaccacatggaggtgttccactgcgagggcggggagcacgaggag
atgcctctgtacaacggcgactgcacaaatttgccggccaaggccaaggtctgctcgaag
gtgatggccctctgggccatgggcgccagcacattcacctatccgccagaggccggcctg
cccattggcggccccggttacaatccctatgtccggctcgaggttcacttcaataatccc
gagaaacaggctggcctcattgacaactccggctttcgcatcaagatgtcgaggactttg
cgacagttcgacgcagccgtcatggagctgggcctggagtatacggacaagatggccata
ccgcccggtcaaacggccttcccattgagcggctactgcgtggcggactgcacgaaggct
gcactgccggcgaccggcatcatcatctttggatcgcagttgcacacgcacctgcgcggc
gtgcgggtacttacgcgccacttccgcggggaccaagagctgcgggaggtgaaccgagac
gactactactcgaatcacttccaggagatgcgcacgctgcactacaagcctcgtgtactg
cccggggatgctctggtgaccacttgctactacaacaccctaaacgacacgaggactgcc
ctggggggcttctccatcagtgacgagatgtgcgtcaactacatccactactacccggcc
accaagctggaggtctgcaagagctccgtgtcggaggagacgctcgagaactacttcatc
tacatgaagcggacggagcaccagcgcggcatccatttgaatggggcacgttcggcgaat
tatcggagcatcgagtggagccagccgcgcgtcgaccaactgtacacgatgtacatccag
gagccgcttagcatgcagtgcaacacatcggacggagggcgctttgcgagccagagctgg
gagggcgtggccccgacggccgtgcaaatcaaaatacccatccaccgcaaactctgtccc
aactataatccgttgtggttgaggccgctggagaagggtgaatgcgatttgcttggcgag
tgcatctactaa

DBGET integrated database retrieval system