KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22809Help
Entry
Dpse_GA22809      CDS       T01032                                 

Definition
GA22809 gene product from transcript GA22809-RA (EC:2.7.11.-)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dpse_GA22809
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   Dpse_GA22809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 355 aa AA seqDB search
MESPRGNLRNVHVENIQNLSTPIRIPPSPMLKTLGYGTGVNVYRLDRSPRLGHPRSPWAI
KRITQRTLDKKDTSFNDRIIHEANILRKLSHPNIVGFRGEMQTSAGVNSLALEMCNTSLG
SILEERFEEELGPLDANHIFKMIMDIAKALDYLHTEAKLLHGDLKSFNVLVKGEFEICKL
CDFGVSLPLDEKNEVKISGEYGLRYVGTTLWSAPEVIDQMDTIDSKADIFSFGLVIYETL
ALVPPHTLMLNDTVDGDEGCDESGVGCLKDDSIVELNSFLEPADDKENDPVLNSLESAYG
TRPPLPEAFELSDDYNTIVELFYLCTNDLGEDRPSARTILKCLPNNAPNIDKSSD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgccgcgaggcaatctgcgtaatgtgcatgtggagaatatacagaacttgagc
acaccgattcgcataccgccatcaccaatgctgaagaccctgggctatggcaccggcgta
aacgtttaccgcctggatcgctcgccccgtcttgggcatccccgttccccgtgggcaatc
aagcgcataacccagcgtacgctggacaaaaaggatacaagtttcaacgaccgcattatc
catgaggcgaatatcttgcgaaaactaagccatcccaacattgttggtttccgcggcgag
atgcagacgtccgctggcgtgaacagcctggccttggagatgtgcaatacctcactgggc
tcgatactggaagagcgcttcgaagaggagctgggaccgctggacgctaatcacatcttc
aaaatgattatggacattgccaaggcgctggactatctgcacaccgaagccaagttgctc
cacggcgacctcaagtcttttaatgtgctcgtgaaaggcgagtttgagatctgcaaactc
tgcgactttggagtttctctgcctctagacgaaaaaaatgaggtgaaaataagtggggaa
tatggtcttcgctacgtgggcaccactctgtggtccgcaccggaggttattgaccaaatg
gatacaattgacagcaaggctgacatcttcagctttggccttgtaatctacgaaacattg
gccctcgtgccgccgcacactctcatgctgaatgataccgtcgatggcgacgagggctgc
gatgaaagcggtgttggctgccttaaggacgactccatcgtcgagttaaacagctttcta
gagccggccgacgacaaggagaacgatcctgttctgaatagcctggagtcggcatatgga
acacgaccacccctacccgaggccttcgagctcagcgacgactacaacaccatcgtcgag
ctattctacctgtgcacgaatgatttgggcgaggatcgcccttcggcccgcaccatcttg
aagtgcctcccgaataatgcgcccaatatagacaagtccagcgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system