KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22927Help
Entry
Dpse_GA22927      CDS       T01032                                 

Definition
(RefSeq) GA22927 gene product from transcript GA22927-RE (EC:3.1.1.5)
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dpse_GA22927
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dpse_GA22927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1455 aa AA seqDB search
MDVLELLRVSGSNMYYSTFLADAWCYYISNQITMTMYLYCALGVLSMLFIGWFVYFKRLA
RLRLRHEIARSLSAVTMASGGDLRGPRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYK
RRAVIRFARRILQLRRENMPLEVRTVEPPAEYLEETMEGSDRVPPDALYMLQSIRIFGHF
EKPIFLRLCKHTQLLELMGGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRK
GESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMAAFQEVFKDSPDVMIRVIQVI
MIRLQRVLFTALRNYLGLNAELVQNHMRFKGSSQGAGPSVYCSQTTRQATGSASATASAA
AASGTAGSTHTAVPRPASSLSRYSQDEQHTLSDPNPGIPNLELSGDSVNTLFGEVNGGAR
LNSYPPLYHQRESDGNLSTRRGSITQQEQPEVGPVPSIDMRLVKSSAVDSLRKELGLPEQ
DAHIIDPFVEVREMEPNVTLITEGNADDVCVWFVMTGTLAVYQGNADATRIKQDKTDLLI
HYVHPGEIVGGLAMLTGEASAYTIRSRNHSRVAFIRRAAIYQIMRQRPRIVLDLGNGVVR
RLSPLVRQCDYALDWIFLESGRALYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYG
KGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLG
SMQTRTTTGAPGAPVEANPVTHKYSTVALVPITDDVPLTPFTYELYHSLCAIGPVLRLTS
DLARKQLGMNIFDASNEYRLTSWLAQQEDRNIITLYQCDNALSPWTQRCMRQADVVLIVG
LGDHSHLVGKFEREIDRLALRTQKELVLLYPETASSKPANTLSWLNARPWVTKHHHVLCV
KRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGML
KAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPI
TSMFSGREFNKTIHETFGDVNIEDLWIPYFTLTTDITASCHRIHTNGHLWRYCRASMSIA
GVFPPFCDYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGW
WLLYKKWNPFTAPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFG
SFDEIRDVGYVFGKNYFEGMAKAGRLGRFNQWFSKEPPKRGNHASLNEYTFIDLAQIVCR
LPETYGLNPSDLFSEDEDCDGYISEPTTLNTDVRRYQVPRGGNSLSLSETEMDMDSDVEM
DLKMERKMDKATQSTPPLQSKAQILRRKHSKEEARHEWEIKREQKQELAREQELEREREL
SQKGTTAGATGYTPNAVIATQTSLIFMDEEDEMDKKKTKDNDRDEVRGSAEDKGKEKEED
KENRSNTNNETKNYL
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaactgttgcgtgtgagtggttcaaacatgtactacagcacattctta
gcggatgcctggtgctactacatctccaatcaaataacaatgacgatgtacctgtactgc
gcccttggcgtgctcagcatgctgttcatcggctggttcgtgtacttcaagcgcctggca
cgactacggctgcgccacgagatcgcccggtcgctgagcgcggtgaccatggcctcgggc
ggggatctgcgcggcccgcgctttcgcaagcgcgacaagatgctcttctacggtagacgc
atgctgcgcaagatgaagaacgtcagcgggcagatgtacagcagcggcaagggctacaag
cggcgggcggtgattcggttcgcccgccgcatccttcagctgcgtcgcgaaaacatgccg
ctggaggtgcgcaccgttgagccgccggcggagtacctggaggagaccatggagggcagc
gatcgagtgccccccgacgccctctacatgctgcagagcatccgcatctttgggcacttc
gagaagcccatcttcctgcggttgtgcaagcacacccagctgctggagctgatgggcggc
gactatctgttcaagatcacagacccggacgacagtgtctacatcgtgcaatcgggcatg
atcaatgtctacatctcgaatgcggacggcagcacgctctccctgaagacggtgcgcaag
ggcgagtcggtgacctcgctgctcagctttatcgatgtgctgtccggcaatcccagctac
tacaagacggtgacggccaaggccatagaaaaatcggtggtcattcgactgcccatggcg
gccttccaggaggtgttcaaggacagtccggatgtgatgatccgtgttattcaggtgata
atgatacgactgcagcgcgttctgtttacggcactgcgcaactacctcggcctcaatgcg
gagctcgttcagaatcacatgcgtttcaagggcagcagtcagggggccgggccttccgtc
tattgctcgcagacaacgcgacaggccactggctcagcatcggctacggcatcggcagcg
gcagccagcggtacagccggttcaacacacacggcggtaccaaggccagccagctccctg
tcgcgttactcacaggacgagcagcacacgctgtccgatccgaatcctggcattccgaat
ctagagctgagcggggacagtgtgaacacactattcggcgaggtgaatggcggcgctagg
ctcaatagctatccaccgttgtaccaccagcgcgaatccgacggtaatctgtccactcgt
cgcggctccataacgcaacaggagcagcccgaggtcgggccagtgccgtcgatagacatg
cgactggtcaagtcttcggcggtggacagtcttcgcaaggagctgggtctgcccgaacag
gatgcccacatcattgatccgttcgtggaggtgcgcgaaatggagccgaatgtgaccctc
atcaccgagggcaatgcggacgatgtgtgcgtgtggtttgtgatgaccggtacactggcc
gtgtaccagggcaatgcggatgctacgcgcatcaagcaggataaaacggacttgctcatc
cactatgtacaccccggagagatagtcggtggcctggccatgcttacgggggaggccagc
gcgtacaccattcgctcgcggaatcacagtcgcgtggcattcatcaggcgtgcagctata
taccagatcatgcgccagcgtccgcgcattgtgctggaccttggcaatggggtagtacgg
cgtctgtcgccgctggtacgccaatgcgactacgccctggactggatcttcctggagtcc
ggcagggccctgtaccggcaggacgagagcagcgacagcacctatatcgtgctcagcggc
cgcatgcgctctgtgatcacacatcccggtggcaagaaggagatcgttggcgagtacggc
aagggcgatctcgtgggcatcgttgagatgatcacggagacgtcgcgcacaaccacagtg
atggcggtgcgcgactcggagttggccaagctcccggagggtctcttcaatgccatcaag
ctgcgctacccgattgtggtgaccaagctgatcagtttccttagccatcgctttctcggc
tcgatgcagacgcgcacgaccactggagcgcccggggcacccgtcgaggccaatcccgtc
acgcacaaatactccacggtggccctggtgcccatcacagacgatgtgcccctgacgccc
ttcacctacgagctctaccactcgctgtgtgccatcggtcctgtcctgcgcctgacctcg
gacttggcgcgcaaacagctgggaatgaacatattcgacgcatcgaacgagtacaggctg
acctcgtggctggcccagcaggaggaccgcaacattataaccctctatcagtgcgacaat
gcgctgagtccctggacccaacgttgtatgcgtcaggcggacgtcgtcctcattgtgggc
ctgggcgaccactcgcatttggtggggaagtttgagcgcgagatcgatcgtctggcattg
cgcacccagaaggaactggtcctactctacccggagacggcgtcctcaaagccggccaac
acgctcagctggctgaacgctcgtccttgggtgaccaagcaccaccatgtgctgtgtgtg
aagcgcatcttcacgcgcaaaagccaataccgcattaatgatctctacagtcgtgtgctg
ctatccgagccgaatatgcattccgatttctcgcgcctggcccgctggctgacgggcaac
tcgattggtctggtgttgggcggtggtggggcacgtggcgcggcccatattggtatgctt
aaggccatccaggaggcgggcatacccatcgacatggtcgggggcgtcagcattggtgcg
ttgatgggggccctctggtgctcggagcggaacattaccacggtcacccagaaggcgcgc
gagtggtcgaagaaaatgaccaaatggttcctacaactcttggatctaacctatcccatc
acatcgatgttctctggacgggagttcaacaagaccatacatgaaaccttcggggatgtg
aatatcgaggatctgtggataccatacttcaccctgacgacggatatcaccgccagctgc
catcgcatccacaccaacggtcacctgtggcgctattgccgcgccagtatgtccatcgct
ggtgtctttccgcccttctgtgattaccgcgacggccatcttctactcgatggctgctac
acgaataatgtgccagctgatgtgatgcacaatctgggcgccgctcacataatcgccatc
gatgtgggatcgcaggacgatacggatctgaccaactacggggacgacctaagcggctgg
tggctgctctacaagaagtggaatccgttcaccgcacccgtgaaggtgcccgatctgccg
gacattcagtcgcggctcgcctacgtctcctgcgttcgacagctggaggaggtaaagaac
tctgattactgcgaatacattcgaccgcccatcgacaagtacaagaccctggcgtttggc
agcttcgacgagatccgcgacgtgggctatgtgttcggcaagaactactttgagggcatg
gccaaggcgggtcggttgggcaggttcaatcagtggttcagcaaggaaccgcccaagcgg
ggcaaccacgcctcgctcaacgagtacacattcatcgatttggcgcagatcgtgtgccga
ctgccggagacctatggcttgaacccgtcggatctcttcagcgaggatgaagactgcgat
ggctacatatcggaaccaacgacactgaacacggatgtccggcgctatcaggtacctcgt
ggcggcaactcgttgtcgttgtctgagactgaaatggacatggactcggacgtggagatg
gatttgaaaatggagcgcaaaatggacaaagctacacagtccacaccgccactacagagc
aaagcacagattctacggcgaaagcattcgaaggaggaggctagacacgaatgggaaatc
aagcgggagcagaaacaggagttggcgcgcgagcaggaactggagcgagaaagggaactc
agtcagaagggtaccactgcgggggccactggctataccccaaacgcagtcatcgccaca
caaacctcgctgatattcatggatgaagaggacgagatggacaagaaaaagactaaagac
aatgacagggatgaggttaggggtagtgcagaggataagggaaaagaaaaggaggaggac
aaagagaacagaagcaacacgaataacgaaaccaaaaactatctatag

DBGET integrated database retrieval system