KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA23005Help
Entry
Dpse_GA23005      CDS       T01032                                 

Definition
GA23005 gene product from transcript GA23005-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA23005
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dpse_GA23005
Messenger RNA biogenesis [BR:dpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dpse_GA23005
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dpse_GA23005
Translation factors [BR:dpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dpse_GA23005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 233 aa AA seqDB search
MRTPVLKRISTSTSEHGETDSETEPQVDPSEGDQEGTGGCPEDEHPVEEVSLPQHPLNHE
WTMWYVEPDRAKTWEETLHQITSFNTVENFWSLYHHIKTPSQIKVGSDYCLFKDGIRPMW
EDEANVNGGRWIVSFPKSATAEMNFFWEYCLLSLIGENCEHSIDLCGAVVNIRLKSDKIA
LWTADCTKEKRILQIGKQLRNGLPANAGFVLQYLQHRDNMAQQDSPLTATYTL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagaacccctgtgctgaaacgcattagcacctccacttcagagcacggggaaacagat
tccgagactgagcctcaagttgatcccagcgaaggcgaccaggaggggactggtggctgt
ccagaagacgagcacccagtggaggaggtgtcgctacctcagcaccccttgaaccacgaa
tggaccatgtggtatgtggagcccgatcgcgctaagacctgggaggagacgctgcaccag
ataacaagctttaataccgtggagaacttttggagtctctaccatcacatcaagacgcca
tcgcaaattaaggtcgggagtgattattgtctgttcaaggacggcattcgccccatgtgg
gaggacgaggcgaacgttaacgggggccgatggattgtcagctttcccaagagtgccacc
gctgaaatgaacttcttctgggagtactgcctgctttccctgataggcgagaactgcgag
cacagcatcgacctctgtggcgctgtggtcaacatccgcctgaagagcgacaagattgcg
ctctggaccgctgactgcaccaaagaaaaaaggatccttcaaataggaaagcaactgcgc
aatggcctgcccgccaatgccggcttcgtcctgcaatatctgcagcacagggacaacatg
gcccagcaggactcccccctaacagccacttatactttgtaa

DBGET integrated database retrieval system