KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA23268Help
Entry
Dpse_GA23268      CDS       T01032                                 

Definition
GA23268 gene product from transcript GA23268-RA
Orthology
K15293  
protein unc-13
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 870 aa AA seqDB search
MSKLLIGWICSECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGE
MDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMV
KLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQGMTHFHCLSAKYLCPGVPAVMST
LLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASS
PEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELY
NREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIG
QLSASSMWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPD
YPAWFEPFVMQWLNENDDVSLEYLHGAFNRDKKDGFTKSSEHALFSNSVVDVFTQLTQCF
DVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKIEFPEHMRDERIACILMNNIQQL
RVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLASQFAISLEPRITQSVRELGDM
LLSIKGGCGNLTAGNQAAQRNAVAVEADDVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKE
LWKIVMRILEKTIVLPPMTDKTVSIASLDPENAEESVGEISVQIDLFSHPGTGEHKVNVK
VVAANDLKWQIPSGMFRPFVEINLIGPHLQEKKRKFATKSKSNNWSPKYNESFSFAIGNE
EQLDFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTIL
RILSQRNNDEVAKEFVKLKSEIRQEPTVGT
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattgttgattggatggatatgcagcgagtgccataattcctctgaccgcata
aaagttcgcgtttgggatgaagacaatgaccttaaatcgaaacttcgtcaaaaattgact
cgagaatcagacgattttttgggacaaaccataattgaagttcgtacgctctccggggaa
atggatgtttggtataatttagaaaaacgaacggataagtcagcagtttcaggtgcaatt
agacttcacatatccgttgaaataaagggtgaagaaaaggttgctccataccatgtccaa
tatacatgtctgcacgagaacctgtttcattatctgtgtgaagaaaatagcggaatggtt
aaattgccaacgcaaaagggtgacgatgcatggaaactctatttcgatgagatccccgag
gaaattgtcgatgagttttcaatgcgctacggtatcgaaaatatctatcaaggaatgacg
cattttcattgcctttctgcgaagtatctttgccctggtgtacccgccgtgatgagcaca
ctgttggccaacatcaatgcgtattacgctcataccacagcttcttctgctgtctctgct
agtgatcggtttgcagctagcaattttgggaaagagaaatttgtcaaattgttggaccaa
ctacataattctctcagaattgacctgtcgatgtatagaaataactttcctgcctcgagt
cctgaaaagttaatggaccttaagtctactgtcgatctactgaccagcataacatttttc
cgcatgaaggtacaagagttgtccagcccaccgagagcgagtactgttgttaaagattgt
gtgaaggcttgtctaagatccacgtatcaattcctgtttgaaaactgctacgaactttac
aacagagagttccaggtggatccaaacgaagcaaagcgtgctccagacgaccatgagcca
aaactggacagcgtagacttctggcacaagctaattgcacttattgtatcggtcatcgat
gaggacaaaaacagctatggcactgtgctaaatcaatttccccaggaacttaatattgga
cagctgtctgcatcgtcaatgtggcatctttttgctgtggacatgaagtacgcattggag
gagcacgaacaacatcgtctctgcaagtcttcggcgtacatgaatctccattttcgcgtt
aaatggctgtatagcaactatgtcaaggaggttccgccctacaaaggagccgtacctgac
tatccagcatggttcgagccttttgtgatgcagtggttaaatgagaacgatgatgtttca
ttggaataccttcacggggcgttcaatcgggataaaaaggacgggtttacgaagagcagc
gagcacgctttgttttcaaattcggtagtcgacgttttcacgcaattgacgcaatgtttc
gatgttgttagcaagctcgagtgtcctgatccagaaatttggaaacgttacatgaggcgt
tttgctaaaacaatcgtaaaagtgctaatagcctatgcagatattgtgaaaattgagttt
ccagagcatatgagggatgaaagaattgcctgcatacttatgaacaacatacagcaatta
agagtacagttggagaaaatgtttgagtctatgggtggggataagctggaagaggacgca
gccaatatactaaaagagcttcaacagaatcttaattctgcactggacgatttggcctca
cagtttgccattagtttggagcctcgaataactcagtcggtgcgtgaactaggtgacatg
ctgctgtctattaaaggaggctgtggaaatctgacagctggtaaccaagccgcacagcgt
aacgctgtcgccgttgaggccgatgacgttttgaggccgcttatggacttgcttgatggt
tcattgacactttatgcgcagtcttgtgaaaagacggtactaaaacgacttttaaaagaa
ctctggaaaatcgtaatgcgaatattggaaaaaactattgttttgccaccaatgactgat
aaaactgtaagcattgcatcccttgatcctgaaaatgcagaggaaagtgtcggcgaaatt
tcagtacaaatagacttattttcccacccaggcacaggtgaacacaaggtgaatgtgaaa
gtggtggctgctaatgatctgaaatggcaaataccatctggaatgttccgaccatttgtt
gagatcaacttgattgggccgcatctacaggaaaagaagaggaagtttgcaaccaagtca
aagtcaaataactggtcgcctaaatacaatgaatcatttagcttcgctattggtaatgag
gaacagctggactttttcgagttgcatatttgcgttaaggactattgttttgcccgtgat
gatcgacttgtcggcgtggcagttatcccgctcaaagacatatcggaaaagggatctgtc
gcctgttggttacctttgcagagacgcatagaaatggacgagacgggttggacaatttta
cggattctatcacaacgtaataatgatgaagtcgccaaggaatttgttaagctgaaatca
gaaatacgtcaggaaccaacagtgggtacttaa

DBGET integrated database retrieval system