KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA23555Help
Entry
Dpse_GA23555      CDS       T01032                                 

Definition
GA23555 gene product from transcript GA23555-RA (EC:2.7.11.-)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dpse_GA23555
   04340 Hedgehog signaling pathway
    Dpse_GA23555
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dpse_GA23555
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dpse_GA23555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 507 aa AA seqDB search
MSAAACARFCTPLTAGGTGSSSKLTAGTGNSSMTSSYKKKSPASDTNTEASFTFKLGRAN
GSSGNGSSSHGVGGGGGGHSVASSESSDPLESDYSEEEEEEPEPKPEQSSHVSSRSSSSA
TTTTSSADHENEVDEEEDDDDENDGDGRDGDDVTNDSNESIEEDDGNETDDEEDEDDSDE
SSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQI
EHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNF
FAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKLRDRTWTLCGTPEYI
APEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIA
KDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYNKKLKPPILPDVHHDGDTK
NFDDYPEQDWKPAKAVDQRDLQYFNDF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagccgcttgcgcccgcttctgtacgccgttgacagctggaggcacaggatcc
tcgtcaaaattgacagcaggaacaggaaacagcagcatgacgtcatcgtacaagaagaaa
agtccagcaagtgacaccaacacagaggcatcgttcacattcaaattgggccgtgcaaat
ggcagcagcggcaacggcagcagcagccacggcgtgggtggcggtggcggcggccatagc
gttgcctcaagtgagtcatcagatcctttggaatccgattacagcgaggaggaagaagag
gagccagagccgaagccggagcagagcagccacgtcagcagccggagcagcagcagtgcc
acaaccacaacaagctccgctgaccatgaaaatgaggtggacgaggaggaggacgatgac
gatgagaatgatggcgatggtcgtgacggcgacgacgttaccaatgattccaacgaaagc
atcgaggaggatgacggcaatgagaccgacgacgaggaggacgaggatgactccgatgag
agcagcagtgtccagacggccaagggagttcgcaaatatcacttggacgactaccaaata
atcaaaactgtgggcactggcacctttggacgcgtgtgcctatgccgcgatcgtatttcg
gagaagtattgtgcgatgaagattttggccatgaccgaagtcattcgtctaaagcagatt
gaacacgtcaagaacgagcggaatatattgcgcgaaatacgacatccgtttgtcatcagt
ttggaatggtccacaaaagatgactcaaacctatatatgatcttcgattatgtctgcggc
ggcgagctgttcacatatctgcgtaatgcaggcaaatttactagtcaaacttccaacttc
tttgcggctgagatcgtcagcgccctggagtacctacactctctacagattgtctaccgt
gatctgaagccagagaatctgctgatcaatcgcgatggccatttgaaaatcacagatttt
ggttttgccaaaaaattaagggaccgcacctggaccttgtgcggaacgcccgagtatata
gcacctgagataatacaatcgaagggccacaacaaggccgtggattggtgggcattgggt
gttctcatttatgaaatgctggtgggctatccaccattctacgatgagcagccctttggc
atatacgaaaagatattgagtggaaaaatcgaatgggaacgtcatatggatcccattgct
aaagacttgatcaagaagctgttggtgaatgatagaaccaagcgactgggcaacatgaag
aacggtgccgatgacgtgaagaggcatcgctggttcaagcacttgaattggaatgacgtc
tacaacaagaaactaaagccaccaattttgcccgatgtacatcatgatggggatacgaaa
aattttgatgattatcccgagcaggattggaagccggccaaggcagtagaccaaagagat
ttgcagtactttaatgatttctaa

DBGET integrated database retrieval system