KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24137Help
Entry
Dpse_GA24137      CDS       T01032                                 

Definition
GA24137 gene product from transcript GA24137-RB (EC:5.-.-.-)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dpo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 490 aa AA seqDB search
MRCLAAAMLIFGYIATTLAAESDVLDLGDDNFASTLKQQETTLVMFYAPWCGHCKRLKPE
YAKAAELVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYSGPREAI
GIAKYMRAQVGPASKNVRSVEELAKFLDTKETSIFGSFEDIDSKLAKIFLKFADKNREKY
RFGHSSDEEVLKKNGETDKIVLIRAPHLSNKFEASTIKFEGSTESDLTTFIKEISNHGLV
GHRTQETSRDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFAGQISFAISSKDDFQ
HELNEYGYDFVGDKPIVLARDAKNLKYSLKDEFSVENLQDFVEKLLADELEPYVKSEPVP
ESNDTPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVVIV
KMDATANDVPPEFNVRGFPTLFWLPKDSKNNPVSYNGGREVDDFIKYIAKEATTELKSFD
RDGRPKKTEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgtctggcagctgccatgctaattttcggctacattgccactacattagccgcc
gagagtgacgtcctggacctgggggacgacaactttgcatccacactgaagcagcaggag
acgacattggttatgttctatgccccctggtgcggccactgcaagcgcctcaagcctgag
tacgccaaggcggctgagctcgtcaaggatgacgatccaccaattaagctggccaaggtt
gactgtaccgaggctggcaaggagacctgcagcaagtactcagtgagcggctatcccaca
ctgaaaatattccgtcaggatgaagtgtcgcaggactacagcggaccacgtgaggccatc
ggcattgcgaaatacatgcgcgctcaggttggacctgcctctaagaatgtgcgctctgtg
gaggagctcgccaagttcctggacaccaaggagacctcaatctttggtagctttgaagac
attgactccaagctggcgaagatcttcctcaagtttgccgacaagaaccgcgagaaatat
cgctttggccacagcagcgacgaggaggtgttgaagaagaatggtgaaaccgataagatt
gtgctgatccgtgctccacatttgagcaacaagtttgaggcttccacaatcaagtttgag
ggaagcactgagtccgacctgaccaccttcatcaaggagattagtaaccatggcttggtt
ggtcatcgtacccaggaaacttcgcgggacttccagaaccccctgatcaccgcctactac
agcgtcgactaccagaagaatcccaagggcaccaactactggcgcaaccgtgtcctgaag
gtggccaaggaatttgccggccaaattagctttgccatcagctccaaggacgacttccag
cacgaattaaacgaatacggctacgattttgttggcgacaagcccatcgttttggcccgt
gatgccaagaatctcaagtactctctgaaggacgagttctccgtggagaacctacaagat
tttgttgagaagctgctggccgacgaactggagccatatgtcaagagcgagcccgtccca
gagtcgaacgatactccggtcaaggtggctgtagctaagaactttgacgatctggtgatc
aacaacggcaaggacacgctcattgagttctacgccccatggtgcggccactgcaagaag
ttgactcccatctacgaggagctggccgagaaactgcaagacgaggatgtggtcattgtc
aaaatggatgccacggccaacgatgtgccaccagagttcaatgtgcgtggattccccaca
ctcttctggctccccaaggactcgaagaataaccccgtaagctacaacgggggtcgcgag
gtcgacgatttcatcaaatacattgccaaggaagcgaccacagaactgaagagcttcgac
cgtgacggaaggcccaagaagaccgagctctaa

DBGET integrated database retrieval system