KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24137Help
Entry
Dpse_GA24137      CDS       T01032                                 

Definition
GA24137 gene product from transcript GA24137-RB (EC:5.-.-.-)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dpse_GA24137
Enzymes [BR:dpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dpse_GA24137
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dpse_GA24137
  Exosomal proteins of colorectal cancer cells
   Dpse_GA24137
  Exosomal proteins of bladder cancer cells
   Dpse_GA24137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 490 aa AA seqDB search
MRCLAAAMLIFGYIATTLAAESDVLDLGDDNFASTLKQQETTLVMFYAPWCGHCKRLKPE
YAKAAELVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYSGPREAI
GIAKYMRAQVGPASKNVRSVEELAKFLDTKETSIFGSFEDIDSKLAKIFLKFADKNREKY
RFGHSSDEEVLKKNGETDKIVLIRAPHLSNKFEASTIKFEGSTESDLTTFIKEISNHGLV
GHRTQETSRDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFAGQISFAISSKDDFQ
HELNEYGYDFVGDKPIVLARDAKNLKYSLKDEFSVENLQDFVEKLLADELEPYVKSEPVP
ESNDTPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLTPIYEELAEKLQDEDVVIV
KMDATANDVPPEFNVRGFPTLFWLPKDSKNNPVSYNGGREVDDFIKYIAKEATTELKSFD
RDGRPKKTEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgtctggcagctgccatgctaattttcggctacattgccactacattagccgcc
gagagtgacgtcctggacctgggggacgacaactttgcatccacactgaagcagcaggag
acgacattggttatgttctatgccccctggtgcggccactgcaagcgcctcaagcctgag
tacgccaaggcggctgagctcgtcaaggatgacgatccaccaattaagctggccaaggtt
gactgtaccgaggctggcaaggagacctgcagcaagtactcagtgagcggctatcccaca
ctgaaaatattccgtcaggatgaagtgtcgcaggactacagcggaccacgtgaggccatc
ggcattgcgaaatacatgcgcgctcaggttggacctgcctctaagaatgtgcgctctgtg
gaggagctcgccaagttcctggacaccaaggagacctcaatctttggtagctttgaagac
attgactccaagctggcgaagatcttcctcaagtttgccgacaagaaccgcgagaaatat
cgctttggccacagcagcgacgaggaggtgttgaagaagaatggtgaaaccgataagatt
gtgctgatccgtgctccacatttgagcaacaagtttgaggcttccacaatcaagtttgag
ggaagcactgagtccgacctgaccaccttcatcaaggagattagtaaccatggcttggtt
ggtcatcgtacccaggaaacttcgcgggacttccagaaccccctgatcaccgcctactac
agcgtcgactaccagaagaatcccaagggcaccaactactggcgcaaccgtgtcctgaag
gtggccaaggaatttgccggccaaattagctttgccatcagctccaaggacgacttccag
cacgaattaaacgaatacggctacgattttgttggcgacaagcccatcgttttggcccgt
gatgccaagaatctcaagtactctctgaaggacgagttctccgtggagaacctacaagat
tttgttgagaagctgctggccgacgaactggagccatatgtcaagagcgagcccgtccca
gagtcgaacgatactccggtcaaggtggctgtagctaagaactttgacgatctggtgatc
aacaacggcaaggacacgctcattgagttctacgccccatggtgcggccactgcaagaag
ttgactcccatctacgaggagctggccgagaaactgcaagacgaggatgtggtcattgtc
aaaatggatgccacggccaacgatgtgccaccagagttcaatgtgcgtggattccccaca
ctcttctggctccccaaggactcgaagaataaccccgtaagctacaacgggggtcgcgag
gtcgacgatttcatcaaatacattgccaaggaagcgaccacagaactgaagagcttcgac
cgtgacggaaggcccaagaagaccgagctctaa

DBGET integrated database retrieval system