KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24298Help
Entry
Dpse_GA24298      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00600  Sphingolipid metabolism
dpo01100  Metabolic pathways
Module
dpo_M00094  Ceramide biosynthesis
dpo_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dpse_GA24298
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     Dpse_GA24298
Amino acid related enzymes [BR:dpo01007]
 Aminotransferase (transaminase)
  Class II
   Dpse_GA24298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 4804658
NCBI-ProteinID: XP_001361185
FlyBase: FBgn0245695
UniProt: Q28Z52
Position
3
AA seq 468 aa AA seqDB search
MAVIQLFNEIGTIFRNTPTFALVLEIFLLITVIWLLLHKRGGGRRRRFTKEEEDFIIENY
EPEPLVGETDPDHPLLRTRLVASKVGKRINVDGHDCLNLGSHNYLGFLEDQDILEEACKS
LRKYGVGSCGPRGFYGTMDVHLELEERIAKFMDLEEAIVYSYGFSTVASAIPAYAKRGDI
IFVDEGVNFAIQKGLDASRSTIAFFKHNDVKDLERLLVEQEKRDQKNPKKALKTRRFLVA
EGIYMNTGKICPLPELVALRKQYKLRIFIDESVSFGTLGKGGRGVTEHFNIDRDEIDLIS
AGMEGSMATIGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRFEREPQIFE
QLQAKAQLLHQIFSRFSKLRLCGDELSPVKHLYLAIPGETFDAERKRLIDVADKCIARGV
AVVEAAYLQNRERKPVRPSIRVAVNRLLEEAEISAAFEIIENVSSAVL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgattcaattatttaacgaaattgggaccatctttcggaatacacccacgttt
gcacttgttctagaaatattcctgctcattaccgtcatctggctgctgctccataaacgg
ggcggtggacggcgccgtcgctttaccaaagaggaggaggacttcataattgagaactat
gagccagaacccttggtgggggaaactgatccagatcatcccttgctgcgcacccgtttg
gtggcgtccaaggtgggcaagcgcataaacgtcgatggacacgattgcctcaacctgggc
tcgcacaactatttgggtttccttgaagaccaggacattctggaggaggcgtgcaagtct
ctgcgcaaatatggtgtcggatcgtgtggtcctcgcggtttctatggaactatggatgtg
cacttggagctggaggagcgtattgccaagttcatggacctcgaggaagctattgtgtat
tcctatggcttttcgacggtggccagcgccattcccgcatacgccaagcgtggcgacatt
atatttgtagatgaaggtgtcaactttgccattcaaaagggattggatgcgtctcgcagc
acgatcgcattctttaaacacaatgatgtcaaggatcttgagaggctgctcgtcgagcag
gagaagcgtgatcagaagaaccccaagaaggctctcaagacgcgtcgatttcttgttgca
gagggcatctacatgaatacgggcaagatttgtccgcttcccgagctcgtggctctgcgc
aagcaatacaaattgcgtattttcatcgatgagagcgtttcctttggcacacttggcaaa
ggaggacgaggtgtcaccgagcacttcaatatcgaccgggacgaaatcgatctgatatcc
gctggtatggagggatccatggccaccattggcggcttctgcgtgggctcacatttcata
gccgagcatcagcgtctctccggcctgggctacatattttccgcttcactgccgcccatg
ctgacccaagctgccatttctgccctcgatcgtttcgagcgggagccgcaaatctttgag
caattgcaggccaaagcccagttgttgcatcagatcttttcgcgtttctccaagctgcgc
ctgtgcggcgatgagttgtcccccgtcaagcacttgtatttggccattcccggagaaacc
ttcgatgcggaacggaagcgcctcatagatgttgccgacaagtgtattgctcgaggcgtg
gcggtcgtggaggcagcctacctgcagaatagggaacgcaagccagtgcgtcctagtata
cgagttgccgtgaaccgtctgctggaagaggcggagatttccgccgcttttgagatcatc
gagaatgttagcagcgcagtcctttag

DBGET integrated database retrieval system