KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24298Help
Entry
Dpse_GA24298      CDS       T01032                                 

Definition
GA24298 gene product from transcript GA24298-RA
Orthology
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dpo00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 468 aa AA seqDB search
MAVIQLFNEIGTIFRNTPTFALVLEIFLLITVIWLLLHKRGGGRRRRFTKEEEDFIIENY
EPEPLVGETDPDHPLLRTRLVASKVGKRINVDGHDCLNLGSHNYLGFLEDQDILEEACKS
LRKYGVGSCGPRGFYGTMDVHLELEERIAKFMDLEEAIVYSYGFSTVASAIPAYAKRGDI
IFVDEGVNFAIQKGLDASRSTIAFFKHNDVKDLERLLVEQEKRDQKNPKKALKTRRFLVA
EGIYMNTGKICPLPELVALRKQYKLRIFIDESVSFGTLGKGGRGVTEHFNIDRDEIDLIS
AGMEGSMATIGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRFEREPQIFE
QLQAKAQLLHQIFSRFSKLRLCGDELSPVKHLYLAIPGETFDAERKRLIDVADKCIARGV
AVVEAAYLQNRERKPVRPSIRVAVNRLLEEAEISAAFEIIENVSSAVL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgattcaattatttaacgaaattgggaccatctttcggaatacacccacgttt
gcacttgttctagaaatattcctgctcattaccgtcatctggctgctgctccataaacgg
ggcggtggacggcgccgtcgctttaccaaagaggaggaggacttcataattgagaactat
gagccagaacccttggtgggggaaactgatccagatcatcccttgctgcgcacccgtttg
gtggcgtccaaggtgggcaagcgcataaacgtcgatggacacgattgcctcaacctgggc
tcgcacaactatttgggtttccttgaagaccaggacattctggaggaggcgtgcaagtct
ctgcgcaaatatggtgtcggatcgtgtggtcctcgcggtttctatggaactatggatgtg
cacttggagctggaggagcgtattgccaagttcatggacctcgaggaagctattgtgtat
tcctatggcttttcgacggtggccagcgccattcccgcatacgccaagcgtggcgacatt
atatttgtagatgaaggtgtcaactttgccattcaaaagggattggatgcgtctcgcagc
acgatcgcattctttaaacacaatgatgtcaaggatcttgagaggctgctcgtcgagcag
gagaagcgtgatcagaagaaccccaagaaggctctcaagacgcgtcgatttcttgttgca
gagggcatctacatgaatacgggcaagatttgtccgcttcccgagctcgtggctctgcgc
aagcaatacaaattgcgtattttcatcgatgagagcgtttcctttggcacacttggcaaa
ggaggacgaggtgtcaccgagcacttcaatatcgaccgggacgaaatcgatctgatatcc
gctggtatggagggatccatggccaccattggcggcttctgcgtgggctcacatttcata
gccgagcatcagcgtctctccggcctgggctacatattttccgcttcactgccgcccatg
ctgacccaagctgccatttctgccctcgatcgtttcgagcgggagccgcaaatctttgag
caattgcaggccaaagcccagttgttgcatcagatcttttcgcgtttctccaagctgcgc
ctgtgcggcgatgagttgtcccccgtcaagcacttgtatttggccattcccggagaaacc
ttcgatgcggaacggaagcgcctcatagatgttgccgacaagtgtattgctcgaggcgtg
gcggtcgtggaggcagcctacctgcagaatagggaacgcaagccagtgcgtcctagtata
cgagttgccgtgaaccgtctgctggaagaggcggagatttccgccgcttttgagatcatc
gagaatgttagcagcgcagtcctttag

DBGET integrated database retrieval system