KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24587Help
Entry
Dpse_GA24587      CDS       T01032                                 

Definition
GA24587 gene product from transcript GA24587-RA (EC:3.4.19.-)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA24587
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C86
   Dpse_GA24587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 193 aa AA seqDB search
MPTTLKIYHEKQTRQLCALHALNNLFQENIYQKAELDNICSNLSPNAWINPHRSLLGLGN
YDINVIMTALEIRHCEAFWFDKRKDPSCIDLDKIVGFILNIPLDYKIGAITLPLRKRHWI
AVRRIGQHYYNLDSKLRQPELLGTESDVLHFLREQLKEKEQQRELFLVRYRSDCNESQQR
WIEESHDINKTAD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaactttgaagatttatcatgagaagcaaacaaggcagttatgtgcgctccac
gctcttaacaatctatttcaagaaaatatttaccaaaaggcagaactggataatatctgc
agtaacttaagtccgaacgcgtggataaatcctcatcgatctcttctgggactcggaaat
tatgatatcaatgttattatgactgccttagagataagacattgcgaagccttttggttt
gataaacgaaaagacccgtcttgcattgacttggataaaattgtgggtttcatacttaat
attccattagattacaaaatcggcgcaataacattaccattacgaaagagacactggata
gctgtgcgtcgcataggtcagcactactataatctggattccaaacttcgacagcctgaa
ttgttgggcacagaatccgacgtgctccactttttgcgggaacagcttaaggaaaaggaa
cagcagcgagaactttttcttgtacgttatcgcagcgactgtaatgaatcacaacagcga
tggatagaagaatcgcacgacataaataaaacagcagattga

DBGET integrated database retrieval system