KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24735Help
Entry
Dpse_GA24735      CDS       T01032                                 

Definition
GA24735 gene product from transcript GA24735-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA24735
Translation factors [BR:dpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dpse_GA24735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 690 aa AA seqDB search
MAKKKSEDHSGGDANDSDYNEEPNFEDPPNFVDNISDDDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPVRLEKLKSVINKLFSHCGDIVNVVYPVDEEGKTKGYAFMEYKHAGQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQSFKVQNDLYNFINDPDAYDQYC
VAAETSQNCVQVGFWQNVLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHTGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKYVARMGDNSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKRETRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEVPVDSVEIRELILAFAWEPIGNKFSIIHGEPNSANVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEDKQKD
IKKNLKKYYPAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIGEWKEQKSRRVMLR
GHVDTDNLETEEVDEEVVEFLVKEEITLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaagagtgaagaccattccggtggcgatgcgaacgacagtgactacaac
gaggaacccaatttcgaagatccgcccaatttcgtggacaatattagcgatgatgatctg
ctcggtgacatgctggcgcagcggccttctgaggccgacggtgtcgagagcgttgtcgtg
gtggacaatatccctaaggtggagccggtgcgtttggaaaaattgaaatcggtcatcaac
aagctcttctcgcactgcggcgatatcgtgaatgttgtttatcctgtcgacgaggagggc
aagacgaagggctatgcgttcatggagtacaagcacgccggccaggcggaggaagccgtc
aagaagctgaacaaccatcggctggataagaaccatacgtttgctgtgaatttgtttacg
gatttccagaagtacgagaacatcccggagaaatgggaaccaccaactgtgcagtccttc
aaggtgcaaaacgatctgtacaacttcatcaatgaccccgatgcgtatgaccaatactgt
gtggcagcggaaacttcccagaactgcgttcaggttggcttctggcagaatgttctgccc
gagcccaacgagctggagacccgcgaacggttcacggacacttttgtcaagtggtcgccc
ctgggcacgtatgtggtgacgttccacaagcccggcgtggccatttggggcggcagcagt
ttccagaagatccagaagttcccccacactggaacacagtttgtggagttctcgccctgc
gaaaactatttggtaacctacggccccaccccgacaggtcagaagattattatttgggac
atacgcactggcgctgagaagcgctcgtttgtggccgacggcatgtcggtcctgtctatg
ttccgttggtcgcacgacgacaagtatgtggccaggatgggcgacaactcgatccacatc
tatgaaacaccctccttctatctgctggatctgaaatccatcaagattcctggcatccga
ggattctcctggtcgcccacggacaatgtgattgcctactgggtggaggagcagaatcaa
atacctgcccgcgtcaccttaatggagatacccaagaagcgggagactcgcaacaagaac
ctattccatgtggccgattgcaagctccactggcagaagtccggcgactatctgtgcgtc
aaagtagatcgctattccaagttgaagaaggacaagaaggagctggacgtcaagttcctg
ggcatgttctacaactttgagatcttccacatgcgggagaaggaggtcccagtcgattcg
gtggagattcgcgagctcatcctggcctttgcctgggagcccatcggcaacaagttctct
attatccacggcgagcccaactccgccaatgtgagcttctacgaggttaacaagggcgtg
aagccgagcctggtcaagcggctggagaagaaatcgtgcacgcatctgttctggtcgcca
cgaggacagttcatagtgatggccaatctgaccatgggcacctttgagtttgtcgattcg
accaatgactacatcatcagtgcgtcgcctgatcatttccgtgcctccgaggttgagtgg
gatcccactggccggtatgtggtcactggcgtctcttcctggaaggtcaaggaggatacc
ggcttcaacatgtacacgttccaggggcgcatcatcaagcgcaccattctgaagaacttt
gtgcagttcctttggcgtcccaggcctccgaccctcctcagcgaggacaagcagaaggat
atcaagaagaacttgaagaagtactatcccgccttcgagcagaaggatcgcctgcgactc
acccgcgcctccaaggagctgctcgagaagcgttcccaactgcgcgagaccttcatggag
tatcgcaacaagcgcattggcgaatggaaggaacagaagagtcgtcgcgtcatgctgcga
ggacatgtggacacagataacttggaaactgaagaggtcgatgaggaagttgttgaattt
ttagtcaaggaagaaatcactcttctagagtag

DBGET integrated database retrieval system