KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA25084Help
Entry
Dpse_GA25084      CDS       T01032                                 

Definition
GA25084 gene product from transcript GA25084-RA (EC:3.1.2.15)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 976 aa AA seqDB search
MSFGLNTQSQSTHVESNNRTLESDLPQKYANGHAMADADHDPYLNERIMSSHEALFSGSL
NSLAQKDESMEEDVVGSGTGLVGLQNIANTCYMNSALQALSNLPPMTHYFINCSDLVEYI
ADQRANARICKPAGLAKSYIRLMQEIWSEIEDPKEYIAPRGILYGIRSVHPIFRGYQQHD
TQEFLRCFMDQLHEELTEQVSPQSRQSQQRQNKQPNETDDENEDEVPPSSHSATGSESEY
ETCESSMSEIAGEVMINTEFFVTPSRTVIGSGTATPEAPPKPQQQRKQKKRETSSDQKPP
IESARSIISDVFDGKLLSAVQCLTCDRVSSRQETFQDLSLPIPTRDFLNVLHQTHSLSVQ
SLSAAETSSRTNDGWLAWMWGLFRSWLYGPSVTLYDCMASFFSADELKGDNMYSCSRCNK
LRTGIKYSRVINLPEVLCIHLKRFRHDLSYSSKISSHVIFPMEGFDMRPYVHKQCKSEVP
IYNLSSVICHHGTVGGGHYTCYARNTLNGRWYEFDDQFVTVVSPDVVQNCQAYVLFYQKH
NPLIKLVREEAKHLSNSHPFCDSDIQFYVTREWLSRLATFSEPGPINNQEMLCPHGGVLH
SKMPMISQIAVPISQPLWDFLCKTFGGGPPVNILFECEICKRAAEALSRRQQHELSEFTK
LNGLHSEFDSSAIFAIDMPWLRSWQNFSRGKTSKEPGPIKNEGIASSTDSNCTIRSVRIG
SDYAQLNARSWRLLHGIYGGGPEILLRQALSDDDEEEIEIIDQDDECYDVESPEAEEENV
TANSYLGNHSDTESSRGRRTTPSPSVSPGPSPKPQPQQTVETTRTPIPEQHNTPKSKRSR
TSVTTLRLNMRKRGKRNRSSFKHADMFGAKGNYNVKTNAEPPAAAPADQDKNKERGKDNE
EKEKTTAFQSEYSIPISIPFQSDNFQVNGLPEKTREKGKRRNSVGGSKSNNNKENVTLQK
FVTVREPSEPTDESEI
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgggcttaacacacaatcgcaaagtacacatgtagaaagcaataatcgtact
ctggagtcggacctgccacaaaagtacgcaaacggacacgctatggcagatgccgaccat
gacccgtatttaaacgaaagaatcatgagttcccatgaagcgctcttcagtggatcgttg
aactcgcttgcccagaaagacgagagcatggaagaggatgttgtcggttccgggacaggc
ctcgtcggactgcaaaacattgccaacacatgctacatgaactcggcactccaagcgctg
agtaatctgccgcccatgactcactacttcatcaactgcagcgatctggtggagtacatt
gcggatcagagagcgaatgcccgaatctgcaagccagcgggtctggccaagagctacatt
cgcctgatgcaggaaatctggtcggagatagaagaccccaaagaatacatcgccccccgt
ggcattttgtatggcatacgatcggtgcatccgatatttcggggctaccagcagcatgac
acgcaggagttccttcgctgcttcatggatcagctgcatgaggaactcacggagcaggtt
tctccacagtcgcggcaatcgcaacagcgtcagaataaacagcccaacgaaactgacgac
gaaaacgaggatgaagtgccgccttcctcgcattcggcgacaggctctgaaagcgaatat
gaaacgtgtgagagcagcatgtccgaaatcgcgggggaagtcatgataaacaccgaattc
tttgttacgccaagccgaactgtcatcggttcaggcactgcgactccagaggctcctcca
aagccgcagcagcagcgtaaacagaaaaaacgtgaaacgtcgtcagatcaaaaaccacca
atagagtcggcgcgttccatcatcagtgacgtgtttgacggcaaactgctctccgccgtt
caatgcctcacctgcgatcgggtgtcctcacggcaggaaacattccaggatctttcactg
cctattcccacaagagacttcctcaatgtgctgcaccaaacgcatagcctaagtgtccag
agtttgagcgccgccgaaacatcaagcagaaccaatgacggctggttggcgtggatgtgg
ggcttgtttagatcgtggctgtatggaccctcggtaacactctacgattgtatggccagt
tttttcagtgcggacgagctcaaaggcgacaacatgtacagctgctcgcgatgcaacaaa
ctgcgaacgggtatcaagtactcgcgtgtaatcaacctgcccgaggtgctgtgcatccac
ctgaagcgcttccgacacgatctgtcctacagctcgaagatctcgtcgcacgttatcttt
cccatggagggcttcgatatgcggccttacgtgcacaagcagtgcaaaagcgaggtgccc
atctacaatctttcatccgtgatctgccaccatggcaccgtcggcggcggccactacacg
tgttatgcacgcaacactctgaacggccgttggtatgagttcgacgaccagttcgtgact
gtggtgagccccgatgtggtgcagaactgccaggcctacgtccttttctaccaaaagcac
aatcccctgataaagctcgtccgcgaggaagccaaacatctgtccaactcacaccccttc
tgcgattctgacattcagttttatgtgacgcgcgagtggctctcccgcctggccaccttc
tccgagccgggtcccatcaataaccaggaaatgctgtgtccccatggcggcgttctacat
tccaaaatgcctatgatcagccagattgcagtgccgatttcccagcccctgtgggacttt
ctgtgcaaaactttcggcggtggaccgccagtgaacattctctttgagtgcgagatttgc
aagcgcgcggctgaggcgctctccaggcgacagcagcatgagctaagcgagtttaccaaa
ttgaacgggcttcacagcgagttcgactcatctgccatttttgccatcgacatgccctgg
ctgcggtcttggcagaacttttcccgcggtaagacctccaaggagccgggccccatcaag
aatgagggaatagcctcttccacggatagcaactgtaccatccgcagtgtgaggatcgga
tcggattatgctcagcttaatgcccgctcatggcggctcctgcacggcatctatggcggc
ggaccggagatcttgctgcgacaggctctctctgacgacgacgaagaagagatcgaaatc
atagaccaggacgatgagtgctatgacgtagagtcgccagaggctgaagaggaaaatgta
acggccaatagttacctgggtaatcattccgacaccgaaagcagccgaggacgccgcacc
accccgagtccaagtgtgagtcccggcccctcgccgaagccgcagccacagcagaccgtg
gagacgaccaggacccccatccctgagcagcacaacaccccaaaatcaaagcgcagcaga
accagcgtgactaccttgcggctcaacatgcgcaagcgagggaagcgcaatcggagcagc
ttcaagcacgcggatatgtttggagccaaagggaactacaatgtcaaaaccaatgcggaa
ccaccagcagcagcaccagcagatcaggataagaataaggaaaggggaaaggataacgag
gagaaggaaaaaaccactgcatttcaaagcgaatacagcataccaatatcgataccattc
caaagtgacaatttccaggtcaacggcttgccggaaaagacgcgcgaaaaggggaagcgg
cggaacagtgttggcggcagcaagtcaaacaacaacaaggagaacgtcaccctgcagaag
tttgtgacggtgcgcgagccctctgagccaacggatgagagtgagatttga

DBGET integrated database retrieval system