KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26003Help
Entry
Dpse_GA26003      CDS       T01032                                 

Definition
GA26003 gene product from transcript GA26003-RA (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 338 aa AA seqDB search
MPKFYKLDINRTEWEIPETYQSLQPVGQGAYGQSAVHAKRTYRELRLLKHMEHENVIGLL
DVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLIYQILRGLKYIHSA
GVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNKTV
DIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPAEEFMSRISSESARNYIRSLPV
MPRRNFRDIFRGANPLAIDLLEKMLELDADQRITAEQALAHPYMEKYHDPTDEQTAALYD
QSFEENELPVEKWREMVFTEVQAFRPTQAFAELLPKDL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagttctacaagctagacataaatcgcacggagtgggagataccagagacatac
caaagccttcagcccgtcgggcagggggcctacggtcagtcggccgtgcatgccaagcga
acgtaccgtgagctgcgcctactgaagcacatggagcacgagaatgtaattggtctcctg
gacgttttccatcccggacagcccgccgactcgctggaccagtttcagcaggtctacatg
gtgacgcatctcatggacgcggacctcaacaacataatacgcacgcagaagttgtctgac
gaccacgttcagttcctgatataccaaatcctaagaggcttaaagtatattcacagtgcc
ggggtgatacatcgcgatttgaaaccgtccaacatcgcggtgaacgaggattgcgagttg
cgcatcttggatttcggtctggcacgacccgcagaaagcgagatgactggctatgtggcc
acgagatggtatcgggcaccggaaatcatgctcaactggatgcactacaacaagacggtg
gacatttggtctgtgggatgcatcatggccgagctcttgaccggacgcaccctcttcccc
ggcaccgatcacattcatcagctgaacctgatcatggaagtgctgggcacgccggcggag
gagtttatgagccgcatctcctcggagagtgccagaaactacatacggtcgttgccagtg
atgccgagacgaaactttcgagacatctttcgtggggccaatccgctggcgatcgacctg
ctggagaagatgctcgagctagatgccgaccagcgcatcacagccgagcaggcgttggcc
catccctatatggagaagtaccatgaccccaccgacgagcagacagcggccttgtacgac
cagagcttcgaggagaacgagttgcccgtggagaagtggagggaaatggtgttcaccgag
gtgcaagccttcaggcccactcaggccttcgccgagctcctgccgaaggatttataa

DBGET integrated database retrieval system