KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26101Help
Entry
Dpse_GA26101      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00511  Other glycan degradation
dpo00520  Amino sugar and nucleotide sugar metabolism
dpo00531  Glycosaminoglycan degradation
dpo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dpo00604  Glycosphingolipid biosynthesis - ganglio series
dpo01100  Metabolic pathways
dpo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dpse_GA26101
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dpse_GA26101
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dpse_GA26101
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dpse_GA26101
   00511 Other glycan degradation
    Dpse_GA26101
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA26101
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dpse_GA26101
Chaperones and folding catalysts [BR:dpo03110]
 Intramolecular chaperones
  Others
   Dpse_GA26101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 6901564
NCBI-ProteinID: XP_002134237
FlyBase: FBgn0247477
UniProt: B5DN57
Position
XL
AA seq 605 aa AA seqDB search
MMLALWIFLVLGVGLARGRGGGGGTKWLCSQTTFCTTESEMVEGENYKKERFESQRDCRL
SCGKYGSVWPMPTGETSLSHNRVHFDPQKIHFDVRTPSEATSQFLDETRRLFLGNLRKEC
RCDCTLASSAKILVKVNVISESLVLDWRTHENYKLFINTTKAAGTVVNIQATTVYGARHA
FETLSNLVTGSVASGLLLVSDVVISDRPVYAHRGLMLDTSRNFIPLSYVRKTINGMAASK
MNVLHWHVVDAHSFPLDITRVPQMRIYGAYSSSQTYSPKEVVQLMKYARLRGIRILIEID
GPAHAHSGWQWGPEEGLGQLSVCLNRIRWEAYCAAPPCGQLNPMNENMYTVLKAIFRQVA
EMGAPEETIHMGGDEVYLSCWNTTKQIRDKMLDDGYDLSEKSFFRLWAQFHQRNLLAWEE
INRRIYPSIPEPKPVILWSSRLTDPLAIENYLPKNRFIIQTWVDSHEPLNKMLLQRGYRI
IVSTKDAWYLDHGFYGSTVYHTWRTVYNNKLPKSRDRRQVLGGEVCMWSESVDQNSLESR
IWPRAGAAAERLWSNPKDAPELIERRFYRYRDRLVDRGIHADAVTPRYCVLHEGMCEHYF
YDTNK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggctctctggattttcctagtccttggcgttggattggcgcggggccgcggc
ggcggcggcggcacaaaatggctgtgcagccagacaaccttctgtacgaccgagagtgag
atggtggaaggggaaaactacaaaaaagagcgctttgagagccagcgggactgccggctg
tcctgcggcaagtacggctccgtttggccaatgccgacgggggagaccagtctgtctcat
aatcgagtgcacttcgatccccagaagatacacttcgatgtgaggacgcccagtgaggcg
accagtcagttcctggacgagacacgacgcctgttcttgggtaatctgcgcaaagagtgc
cgctgcgactgcacgctggccagcagcgcgaagatcctggtcaaggtcaacgtgatcagc
gaaagcctggtccttgactggcgcacgcacgagaactacaagctgttcatcaacacaacg
aaggcggcgggcaccgttgtgaacatccaggccacaacggtgtacggagctaggcatgcc
ttcgagacgctgagcaatctggtaacgggcagcgtggccagtggcctgctgctggtcagc
gacgtcgtcatctccgatcgtccagtctacgcacatcgcggcttgatgttggacacttcc
cggaactttatacccctgtcgtatgtgcggaaaaccatcaacggcatggccgcctccaag
atgaatgtgctccactggcatgtggtggacgctcacagcttcccgctggatatcacccga
gtgccccagatgcggatctacggagcctattccagctcgcagacctactcccccaaggaa
gtcgtccagctgatgaagtacgcccgcctcaggggcatccgcatcctcatagagatcgat
gggcctgcgcacgcccacagcggctggcagtggggcccagaggaggggctgggtcagttg
tccgtgtgcctgaacaggattcgctgggaggcctactgcgcggctccgccttgcggccaa
ctgaatcccatgaacgaaaacatgtacacggtgctgaaggcgatcttccgccaggtggca
gagatgggggcaccggaggagaccatacacatgggcggcgacgaggtgtacttgtcgtgc
tggaacaccacaaagcagatccgagacaagatgctggacgatggctacgacctcagcgag
aagagcttcttccgcctctgggcgcagttccatcagcgcaatctcctggcctgggaggag
atcaatcggcgcatatatcccagcattccagagcccaagccggtcattctctggtccagc
cgcctgacggatcccctcgccatcgagaactacctgcccaagaatcggttcatcatccag
acctgggtcgactctcacgagcccctaaacaagatgctgctgcagcgaggctaccgcatc
attgtctccaccaaggatgcctggtatctggaccatggcttctacggtagcaccgtatac
cacacctggcggaccgtctacaataacaagctgccgaaaagtcgcgatcggcggcaggtc
cttggcggcgaggtgtgcatgtggagcgagtcagtcgatcaaaactcgttggagtcacgc
atctggccgcgagctggggccgccgccgagcggctctggtcgaatccaaaggacgcgccc
gagctgatagagcgtcgcttctatcgttatcgggatcgtctcgtcgaccgtggcatccac
gcggatgccgtaacccctcgctactgtgtccttcacgagggaatgtgcgagcactatttt
tacgacacaaataaataa

DBGET integrated database retrieval system