KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26154Help
Entry
Dpse_GA26154      CDS       T01032                                 

Definition
GA26154 gene product from transcript GA26154-RA (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dpse_GA26154
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dpse_GA26154
  Amino acid metabolism
   00310 Lysine degradation
    Dpse_GA26154
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dpse_GA26154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 479 aa AA seqDB search
MTGIISIITRRLPNSVQTIGLRAVRSSELKRCLRQYSRLVAVSVARQQQLLNQDANLLCQ
EVPRAITWQGFHTTSHLWQEQSVKVPPFADSIAEGDIKFTCKVGDSFAQDEAVMEIETDK
TTVPVPAPFAGQITDILVKDGDTVKPGQELFKMKPGAAPAKAAGAAAPAPAPAAPKPAPA
AAAPKPAAPAPAAARPPPPPPAAARPPPPPPAARPPPAAPRAAAPPPAALAQVKLPPADG
TRQILGTRSEQRVKMNRMRQKIAARLKDAQNTTAMLTTFNEIDMSYAMNFRKQNLDAFVK
KYGIKLGFMSIFSKASAYALQDQPVVNAVIDGTDMVYRDYVDISVAVATPRGLMVPVIRN
VESMNYADIEITLAGLADKAKRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAIL
GMHGIFERPIAVKGEVKIRPMMYVALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtatcatttccataataacgaggcggctgccaaacagtgtccaaaccattggc
ctgcgcgccgtgcggagttctgaactgaagcgctgcctgcgacagtattcccgtcttgtt
gccgtgtctgtggccaggcagcagcaactcctcaaccaagatgccaatctactctgccag
gaagtcccgcgggccattacatggcagggcttccacaccacctcgcacctgtggcaagag
cagtcggtgaaagtgccaccatttgccgactcgatcgccgagggcgacatcaagttcaca
tgcaaggtgggcgactcttttgcccaggacgaggcggttatggagatcgaaaccgacaag
acgacggtgccagtgccagctccgtttgccggccaaatcaccgacattctggtcaaggac
ggggacaccgtcaagcctggccaggagctgttcaagatgaagccgggtgcggctcctgct
aaggcggcgggtgcagccgcaccagctcccgctccagctgcccccaagccagctcctgct
gccgccgctcctaaaccagctgcgccagcaccagctgctgcccggccgccaccaccgcca
ccagcggctgctcgtccgccaccaccaccaccagcggctcgtccgccaccggctgctcct
cgagctgccgcgcctccgccagctgccctcgctcaggtgaagctgccgcctgcagatggc
acccgccagatcctaggtacccgctccgagcagcgcgtcaagatgaaccgcatgcgccag
aagattgcggctcgcttgaaggacgcccagaacaccacagcaatgttgaccaccttcaac
gagatcgacatgagctacgccatgaacttccggaaacaaaacctggacgcattcgtcaag
aagtatggcatcaagctgggcttcatgtccatcttctccaaggccagtgcctatgcgctc
caggaccagcccgtggtgaacgctgtcatcgatggcacggacatggtttaccgcgattat
gtggacatctcggtggccgtggccacaccccgtggactgatggttcccgtcatccggaat
gtggagagcatgaactatgccgacattgagattacattggccggtctggccgacaaggcc
aagcgcgacgccatcaccgtagaggacatggacggcggcacctttaccatcagcaatgga
ggagttttcggctccctgatgggcacgcccatcatcaatccacctcagagtgctattctc
ggcatgcacggcatcttcgagcgtcccatcgccgtcaagggagaggtcaaaattcgtccc
atgatgtatgtggcgctgacctatgatcaccggatcatcgatggacgcgaggccgttctg
ttcctgcgcaagatcaaggctgccgtggagaatcctgcaatcatcgtcgccggcttgtag

DBGET integrated database retrieval system