KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26154Help
Entry
Dpse_GA26154      CDS       T01032                                 

Definition
GA26154 gene product from transcript GA26154-RA (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dpse_GA26154
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dpse_GA26154
  Amino acid metabolism
   00310 Lysine degradation
    Dpse_GA26154
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dpse_GA26154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 479 aa AA seqDB search
MTGIISIITRRLPNSVQTIGLRAVRSSELKRCLRQYSRLVAVSVARQQQLLNQDANLLCQ
EVPRAITWQGFHTTSHLWQEQSVKVPPFADSIAEGDIKFTCKVGDSFAQDEAVMEIETDK
TTVPVPAPFAGQITDILVKDGDTVKPGQELFKMKPGAAPAKAAGAAAPAPAPAAPKPAPA
AAAPKPAAPAPAAARPPPPPPAAARPPPPPPAARPPPAAPRAAAPPPAALAQVKLPPADG
TRQILGTRSEQRVKMNRMRQKIAARLKDAQNTTAMLTTFNEIDMSYAMNFRKQNLDAFVK
KYGIKLGFMSIFSKASAYALQDQPVVNAVIDGTDMVYRDYVDISVAVATPRGLMVPVIRN
VESMNYADIEITLAGLADKAKRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAIL
GMHGIFERPIAVKGEVKIRPMMYVALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtatcatttccataataacgaggcggctgccaaacagtgtccaaaccattggc
ctgcgcgccgtgcggagttctgaactgaagcgctgcctgcgacagtattcccgtcttgtt
gccgtgtctgtggccaggcagcagcaactcctcaaccaagatgccaatctactctgccag
gaagtcccgcgggccattacatggcagggcttccacaccacctcgcacctgtggcaagag
cagtcggtgaaagtgccaccatttgccgactcgatcgccgagggcgacatcaagttcaca
tgcaaggtgggcgactcttttgcccaggacgaggcggttatggagatcgaaaccgacaag
acgacggtgccagtgccagctccgtttgccggccaaatcaccgacattctggtcaaggac
ggggacaccgtcaagcctggccaggagctgttcaagatgaagccgggtgcggctcctgct
aaggcggcgggtgcagccgcaccagctcccgctccagctgcccccaagccagctcctgct
gccgccgctcctaaaccagctgcgccagcaccagctgctgcccggccgccaccaccgcca
ccagcggctgctcgtccgccaccaccaccaccagcggctcgtccgccaccggctgctcct
cgagctgccgcgcctccgccagctgccctcgctcaggtgaagctgccgcctgcagatggc
acccgccagatcctaggtacccgctccgagcagcgcgtcaagatgaaccgcatgcgccag
aagattgcggctcgcttgaaggacgcccagaacaccacagcaatgttgaccaccttcaac
gagatcgacatgagctacgccatgaacttccggaaacaaaacctggacgcattcgtcaag
aagtatggcatcaagctgggcttcatgtccatcttctccaaggccagtgcctatgcgctc
caggaccagcccgtggtgaacgctgtcatcgatggcacggacatggtttaccgcgattat
gtggacatctcggtggccgtggccacaccccgtggactgatggttcccgtcatccggaat
gtggagagcatgaactatgccgacattgagattacattggccggtctggccgacaaggcc
aagcgcgacgccatcaccgtagaggacatggacggcggcacctttaccatcagcaatgga
ggagttttcggctccctgatgggcacgcccatcatcaatccacctcagagtgctattctc
ggcatgcacggcatcttcgagcgtcccatcgccgtcaagggagaggtcaaaattcgtccc
atgatgtatgtggcgctgacctatgatcaccggatcatcgatggacgcgaggccgttctg
ttcctgcgcaagatcaaggctgccgtggagaatcctgcaatcatcgtcgccggcttgtag

DBGET integrated database retrieval system