KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26519Help
Entry
Dpse_GA26519      CDS       T01032                                 

Definition
GA26519 gene product from transcript GA26519-RB
Orthology
K03259  
translation initiation factor 4E
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA26519
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dpse_GA26519
Translation factors [BR:dpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dpse_GA26519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 216 aa AA seqDB search
MSMEKVATKQYESKVWPDLVDSDDSDVENEIDVEKLPPLEVGPNENRLQHTYCLWFSRKG
TQRAATDYSKSLHVVGRCASVQQWWSLYSHLIRPTALKPYRELSLFKQGIKPMWEDPANS
KGGQWLIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKYPEDSLSVWNRTATDM
TSTTRIRDTLRRILNIPITTTMEYKIHCDSLKYVSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggaaaaggttgcaaccaaacaatatgaatcgaaagtctggccggatcttgtc
gatagtgacgacagcgacgtagagaatgaaatagatgtggaaaaattaccgccgctggag
gtggggcccaatgagaatcgcctacagcacacatactgcctttggttctcgcgaaagggg
acacagcgggccgccacggactatagcaaatcgctgcacgtggtcggaaggtgtgcaagt
gtccagcaatggtggtccctctactcgcatctgatccggccgactgccctgaagccgtac
cgagagctgtccctattcaaacaaggcatcaaaccgatgtgggaggatccggcgaatagt
aaaggcggccaatggctgataagattgcgcaaaaacaaaattgaacgtgcctgggagaat
gtctgcatggcgatgctgggtgagcaatttctggtgggtgacgagatatgcggcatagtg
ctgcagacaaagtatccggaggatagcttatcagtatggaaccggactgccactgatatg
accagtacaacacgtatccgtgatacgttacgcaggatattaaatatacctataacaact
acaatggagtataagatacactgtgatagccttaaatatgtttcaaagtaa

DBGET integrated database retrieval system