KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26611Help
Entry
Dpse_GA26611      CDS       T01032                                 

Definition
GA26611 gene product from transcript GA26611-RA (EC:3.4.21.-)
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dpse_GA26611
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dpse_GA26611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 662 aa AA seqDB search
MFIAAAAWSCTAASWRLLSAGLLALSLLQLAVETGAGSSGGLGNQAVFTSSFLVRFRRNV
DNDFAHQVADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPSVHTAV
QQPGFKRVKRGLRPAVPAIHGMKFDLKQGEANRIEEEPTDPYFPMQWYLKNTGQNGGKVR
LDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDD
WFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIH
IYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYA
ASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTS
AAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLF
GFGVLDAGAMVTLSKQWHAVPPRYHCEAGAITQSQAIIMGRSLFWDIKTDACKGTDTEVN
YLEHVQAVISANSTRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGE
YPQGTWKLEARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKK
MK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgcagcagccgcctggagctgcactgctgcttcatggcgcctgctgagcgcc
gggctgctagccctctccctgctccaactggccgttgagacgggtgccggatcgagcggc
ggattgggcaatcaggccgtgttcactagctcgttcctggtgcgcttccggcgcaacgtt
gacaatgacttcgcccaccaggtggccgacaaatatggcttcgacaacctggggccgctg
gtcggcgccgacggacacgagtatcatttcaagcaccgaaccctgccgcatgcccgctcc
agacgcagtttgacgcacacgcgtgccctcaagagccatccctcggtacacacggctgtg
caacaacccggattcaagcgcgtcaagcggggactgcgaccggcagtgcctgccattcat
ggcatgaaattcgatttgaagcagggggaggccaaccgcatcgaggaggagcccacggac
ccctacttccccatgcaatggtacctgaagaacaccggccagaacgggggcaaggtgcga
ctcgacctgaatgtgcaggcggcctgggcccagggcataaccggaaagaatgtgaccacg
gcaatcatggatgatggcgtggactacatgcatccggacctgaaatttaattataatgcc
gaggccagctatgacttcagcagcaatgatccctttccctacccacgttacactgacgac
tggtttaacagtcatggaacccgttgtgccggcgaggtggctgctgccagagataatgga
atttgcggtgtcggcgttgcttatgacagcaaaatcgcaggcatacgcatgctggatcag
ccgtatatgacggatctaatcgaggccaactccatgggccatgagccgcacaaaatccac
atctacagcgcctcctggggccccacggacgatggcaaaacggtcgacggtccccggaat
gccaccatgagggcgattgtccagggcgtcaatgagggtcgaaatggtctgggcaacatc
tacgtctgggcatcgggcgatggcggcgaggaggacgactgcaactgtgatggctatgcc
gcctccatgtggacgatttccattaacagcgccattaacgacggccagaacgctcactac
gacgagagctgcagctccacgctggcatccacgttcagcaacggtgccaaggaccccaac
acgggcgttgccaccactgacctgtacggcaagtgtacgaccactcactcgggcaccagt
gcggcggcgcccgaagcagcgggcgtctttgctttggccttggaggcaaacccacaactc
acttggcgcgacatccagcatctgacggtgctgacatcgaagcgcaactctctgttcgat
gccaagaaccgcttccactggacaatgaacggcgtgggcctggagttcaaccacctcttc
gggttcggcgtgctcgatgctggtgccatggtgacgctctccaagcaatggcatgcagtg
ccaccgcgctaccattgcgaggcgggcgcgataacccaatcgcaggcaattatcatgggt
cgctcactgttctgggacattaagaccgatgcctgcaagggcactgacacggaggtcaac
tacttggagcacgttcaggcggtgatctcggcgaattctacgcgacgcggcgacctggaa
ctcttccttacatcccccatgggcaccaaatcaatgatcctgtcgcgtcgcgccaatgat
gatgaccatcgcgatggcttcaccaagtggcccttcatgaccactcattcctggggcgag
tatccgcagggaacctggaagctagaggcacgtttcaattcccctcaaacccgacatggt
aatctgctggaatggtctcttgtgctgcatggcaccaaggaggcgccctatcgcactctg
cacccatcctcgccgcactcgaagctggccatcgtgaagaaggcccacgaggacaagaag
atgaagtag

DBGET integrated database retrieval system