KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26775Help
Entry
Dpse_GA26775      CDS       T01032                                 

Definition
GA26775 gene product from transcript GA26775-RA
Orthology
K04437  
filamin
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA26775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 2558 aa AA seqDB search
MYNGEIERRENAGARETPSAIVASKAFSTRNSNDADDGPVPVPISVHANYTNGGQTAATQ
ATIFLSHSNNSHHLNNRKNPPNFQTNACVNGSGNGNNHTEQNASQFVPNFSNLNFYAQQP
TSAQNNNNNNYDVCHQQPNDYYQQQQQPADQYEENFDEDMEAERDLAEDAQWKKIQQNTF
TRWANEHLKTIDRSINNLETDLSDGLRLIALLEVLSQKRLPKYNKRPTFRSQKLENVSVA
LKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGPTP
KQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDSKDAVQNASEA
MGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYG
PGIEPIGPVVGAPANFTVETFSAGKGAVDVDIEGPNGEIEKADVRFNNDKNLTYTVSYIP
KAEGPHKVTVQFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPTGVTIKKPTFFDILA
KDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSINVFYAGTAIPNS
PFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGMNQN
VMQSKVDGNTYDCHYYPTKEGRYVIMVTFAGQEVPKSPFEVKVGPKKESSIVAYGPGLSS
GVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILC
DNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTISQPTSFDVDTSKAGNAPLDVV
VQDVYGTKLPVQLASNPDGSKKATYTPISGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAA
KVQAFGPWLQPGVRPNVPTHFNVDAREAGEAELKVKIIHEETKIEVPCRIIDNEDSTYSV
EVMPPAKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITH
GLPKADLAVTITSPSGNRVKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRL
QCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGD
GTCNVAYLPTESGDYTVNITFNDRHINGSPFQPMIVPVPNLKNTRVSGIGIQPHGVIMNA
ATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIE
LMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAI
EGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVK
VYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNSIYAVHY
VPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEATKVKVKGVNEKKKTPASLPAEFEID
TKQAGQADINVAIKNPKGKPMQPRLEEVATGTYVVSFVPDECGTYQCSIKYGDKEIEGSP
FKLEAFPTGEAKKCKLVEQAPKIQPSGSQSHLKVDAREAGNGAVTCKITNKEGSEIVGID
VVEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEEYSHSEYIEEHTTKV
VQKTTQSELVNGKSETSYRSVAFEKLPLPTTGGNVTAEVKMPSGKVDKPVIQDNRDGTVS
VKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGITGEPANFTIS
TKGASAGGLTMAVEGPSKAVINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDRHIKGSPYF
AKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIG
ISFTPRETGEHLVSVKRLGKHISNSPFKVTVCEREVGDAKKVKVSGAGLKEGQTHADNIF
SVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGS
PFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTE
DAEIQEIEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGS
GLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYR
VGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGDLDA
RIVAPSGTDDDCFIQAIDSEMTSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKNVAD
PAAVHATGNGLEEVKTGHKADFIINTCNAGVGTLHVSIDGPSKVAMDCTEVEEGYKVRYT
PLLPGEHYITVKYNNVHIVGSPFKVDAVGDKLADEGAQETSTVILETVQKVAKGGKNTGV
HLPNFKSDASKVVPKGMGLNRAYIGKQNQFSICATDAGNNILYVGMYGPKGPCEEFHVKH
AGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 7677 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacggagagatagagagacgcgaaaatgccggtgcgcgagaaactccgtcggcg
atcgtcgcgtcaaaagcattttcgacgcgcaacagtaacgacgctgacgacggtcccgtc
ccagtcccaatatccgttcacgcgaattatacaaacggtggtcagacggcggcgacacag
gcgaccatattcctcagccacagcaacaatagccatcatctcaacaatagaaaaaacccg
ccaaatttccagacaaacgcgtgtgtcaacggcagcggcaacggcaacaaccatacagag
cagaacgcatcgcaatttgtgccaaattttagcaatttaaatttttacgcccaacagcca
acgtcagcacagaacaacaacaacaacaactacgacgtttgccatcaacagccgaacgac
tattaccaacaacagcagcagccggcggaccagtacgaggagaacttcgacgaagacatg
gaggctgaacgtgatcttgccgaggatgcgcagtggaagaagatccaacagaacaccttc
acacggtgggcgaacgagcacctgaagaccatcgatcgatcgataaacaatctggaaacg
gatctgtccgatggcctgcggctgatcgccctcctcgaggtgctgtcccagaagcgtttg
cccaagtataacaaacgtccaacattccgcagccagaaattggagaacgtatcggtggcc
ctgaaattccttcaggatgagggcatcaaaatcgttaacattgactcctcggacattgtg
gactgcaagctgaaactgatactgggcctgatatggacgctcattctccactactcgata
tcgatgcccatgtgggatggcgaggatgagaagcagctgaacggctccggaccgacgccc
aagcagcgcctactgaactggatacatgccaagatacccgatttgcccatcaataacttc
accaatgactggaccactggcaaggcggtgggcgctttggttgatgcctgtgccccgggt
ctgtgccccgactgggagatgtgggactcgaaggatgctgtccagaatgcatcggaggcc
atgggtctggccgacgattggttgaatgtccgtcagctgatcaagcccgaggagctggtc
aatcccaatgtcgacgagcagtccatgatgacgtacttgtcgcagtatcccaactccaag
ctgaagacgggagcaccactgaggcccaagacgaaccccaacagagtgcgtgcctatggt
cctggaattgagccaattggtcctgtggttggtgccccagccaatttcacagtggaaacc
ttctccgctggcaagggtgctgtcgatgtggacatcgagggacctaacggagagatcgaa
aaagccgatgtgcgcttcaacaatgacaagaatctcacatacacggtctcgtacataccc
aaggccgagggaccgcacaaggtcaccgttcagttctctggccgcgacatacccaagtct
ccgttccccgtgaaggtggagggacatgccggcgatgcctcaaaggtgaaggtaactggc
cccggtatccagcccacgggagtgaccatcaaaaagcccacattcttcgacatcctcgcc
aaggacgcgggtcgcggcgtgcccgaggtgatcatcatcgatccggccaaccacaagacc
tcggtggcagccaaggtgcgccagttggagaacgatacttggcgctgcgaatacgtgact
gccctgcagggcctgcactccatcaatgtgttctatgcgggcactgctatcccgaacagt
ccgttccccgtgaaggtggcgccgctgtcggacgcccgcaaggtgcgcgcctccggacgc
ggcctccaggccacgggcgtgcgtgttggggacgatgccgacttcaagatccacaccgag
ggagccggcgagggtgtgcccgaggtgcgcgtcattgggcccggtggcatgaaccagaac
gtcatgcaatcaaaggtcgatggcaacacctacgactgccactactaccccaccaaggag
gggcggtacgtaatcatggttacctttgccgggcaggaagttcccaagtccccgttcgag
gtgaaggtcgggcccaagaaggagtcctccattgtggcctatgggccgggactgagcagt
ggcgtcattggctatccggccgccttcgtggtggagaccaatggcgagacgggcgccctc
ggattcactgtggccggcccctcacaggcggagatcgagtgccacgacaatggcgatggc
tccgcactcgtcaagtatcatccgactgccgtgggcgagtatgccgtccacatcctgtgc
gacaacgaggacatacccaagtcgccgttcattgcccagatcctgccacgcaccgacttc
catccggagctggtgaaggcctcggggccgggcctcgagaagaatggcgtgaccatcagc
cagccgaccagcttcgatgtggacacgagcaaggcgggtaatgctcccttggacgttgtc
gtgcaggatgtctacggcacaaagttgcccgtgcagttggccagcaatcccgatgggagc
aagaaggccacctacacgcccatctctggggtgccacacacggtggaagtcaactatgga
ggcgtttccacgcccaactccccgcatcgtgtgtacgtgggcgtccctgtggatgctgcc
aaggtgcaggcgtttggtccctggctgcagccaggagtccgtcccaatgttcccacccac
ttcaatgtggatgcccgggaggcgggcgaggccgagctgaaggtgaagatcatccacgag
gagaccaagatcgaggtgccctgcaggatcatcgataacgaggacagcacctactcggtg
gaggttatgccgccagccaagggagcctacaccacgaccatgacatacgggggccagcgc
gtgccactcggccagaaggtggtcgtggaacagacagtggatgtgtccaagatcaaggtg
gacggactcgagcccaccgcgcccctgaacagtttgcagcagttccgcatcatcacccac
gggctgcccaaggcggatctggctgtgaccatcaccagcccctcggggaatcgtgtcaag
gcccacataatacccacagccgagggatttctggtaaactttacacccacccagctgggg
gagtatctgttgagcatttgctttggcggcacacccattacgccgcgtccattccggctg
cagtgcctcacgggcagcgattccaacaaagtgcaggcctttggcccgggtctagagcgc
ggcattgtgggtcagccggcggagttcatgatcgatacgcgcggtgccggccaaggaggt
ctgggcgtgaccgtggaggggccctgcgaggcggccataaactgccgtgacaatggagac
ggcacctgcaatgtggcctacctgcccaccgaatccggggactatactgtcaacataacg
ttcaatgaccggcacatcaatgggtcgccattccagccgatgattgtgcccgtgccgaat
ctgaagaatacaagagtcagcggcatcggcatccagccgcatggtgtcatcatgaatgcc
gccacagactttatggtggacatgagcaaggtgggcagcaacattgactcgggaaagctg
tcctgcgccattttcgatcccatgggccatgtgctgcccagcaagatcgtccagggaccc
accgacgacatcttccgcatcatgtacacgcccttcgaggctggtcgccacaccattgag
ctgatgtacgacaacataccagtgccgggctcccccttcgtggtgaatgtgaagagcggc
tgtgatccggcgcgctgcaaggcctacggccctggtttggagaagggtctgaccaaccag
aagaacaagttcaccgtggagaccaagggcgccggcaacggtggcctgtcgctggccatt
gaggggccctccgaggcgaagatgacctgcacggacaatcgcgacggcagctgcgatgtt
gactatttggccaccgatccgggggagtacgacatcaccattcgatttgcggacaagcac
atacccggttcgccgttccgcgtgctcgtcgaggagaccgtagatcccagcaaggtgaag
gtgtacgggcctggcatcgagcacggccaagtgcgcgagagtgtgccgaccttcttcaat
gtggatgtgggcgaggctggtcctggccgcatcgccgtcaagctgaccaactccgagggc
atacccgttgacaatctgcgcgtcgaggacaagggcaattccatttacgcggtccactat
gtcccgccaaaggcgggctctgtgctcacgtgccaggtgaagttctccgaggtggaggtg
ccatgcagtccatttgtgatgacagtcttccctaagtcggaggccaccaaggtcaaggtg
aagggtgtcaatgagaagaagaagacacccgcctcgctgcccgccgaattcgagatcgac
acaaagcaggccggccaggcggacatcaatgtggccatcaagaatcccaagggcaagccc
atgcagccacgcctggaggaggtagccactggcacctatgtggtgtcgtttgtgcccgac
gaatgcggcacctatcagtgcagcatcaagtacggcgacaaggagatcgagggctcgccc
ttcaaactcgaagcattccccaccggcgaggccaagaagtgcaagctggtggagcaggcg
cccaagatacagccctcgggcagtcagtcgcacctgaaggtggatgcacgggaggccggc
aatggggccgtcacctgtaagatcaccaacaaggagggcagcgaaatcgtgggcattgat
gtggtcgagaaggacggcttcttcgatatactgtacgccctgaacgatcccggggactac
gacatcaatgtgaagttcggcggcaaagacatacccaacggcagcttctccatcaaggct
gtcgaaagcatcgaggaatattcgcacagcgaatacatcgaggagcacacaaccaaagtg
gttcagaaaacaactcaaagcgaacttgtcaacggaaaatccgagacctcctaccgaagt
gttgcctttgagaaattgccactacccacaacaggcggcaacgtcacagctgaagtcaaa
atgccaagcggtaaggtagacaaacccgttatccaggacaaccgtgatggaaccgtctcg
gtaaagtacgatccccgcgaagagggctcccacgagctggtcgtcaaatacaatggagaa
cccgtccaaggttcccccttcaaattccacgtcgattcgatcacctcgggctatgtgacg
gcctacggaccgggtcttacccacggcatcactggcgaacccgccaacttcaccatctcg
accaagggagccagcgccggtggcctgaccatggccgtcgagggacccagcaaggcagtt
atcaactaccatgacaacaaagacggcactgtatcggtgcaatacctgcccacagcgccg
ggcgagtaccaggtgtcggttcgcttcggcgacaggcatatcaagggatccccgtacttt
gccaagatcaccggcgagggtcgcaagcgcaaccagatctcggtgggctcttgctcggag
gtgaccatgcccggcgacatcaccgacgatgatctgcgcgccctgaacgcctccatacag
gcgcccagcggcctggaggagccgtgcttcctcaagcgcatgcccaccggcaacattggc
atttcgttcacgccccgcgagaccggcgagcatctggtctcggtgaagcgcctgggcaag
cacatcagcaactcgcccttcaaggtcactgtctgtgagcgcgaggtgggagatgccaag
aaggtcaaggtgagcggagccgggctcaaggagggccaaacgcacgcggacaacatcttc
tcggtggacacccgcaacgccggcttcggcggtctctccgtctcgatcgagggtcccagc
aaggccgagatccagtgcacggacaaggacgatggcaccctaaacatctcgtacaagccc
accgagccaggctactatattgtcaatctgaagttcgccgatcatcacgtagagggatca
cccttcaccgtcaaggtggccggtgagggcagcaacaggaagcgggagaagattcagcgg
gagcgcgacgccgtgcctatcacggagatcggcagccagtgcaagctgacgttcaagatg
cccggcatcacctcgttcgatctggccgcctgcgtcacctcgcccagcaacgtcaccgag
gatgccgagatccaggagatcgaggacggcctctactcggtgcactttgtgcccaaggag
ctgggcgtgcacaccgtctcggtgcgctactccgagatgcacatacccggctcccccttc
cagttcactgtcggtcccctgcgcgactccggcagccatttggtgaaggccggaggctcc
ggcctggagcgcggcgtcgtcggggaggcagccgagttcaatgtgtggacccgcgaggcg
ggcggtggctctctggccatctccgtggagggtcccagcaaggcagacatcgagttcaag
gatcgcaaggacggcagctgcgatgtctcgtacaaggtcaccgagccgggagagtaccgc
gttgggcttaagttcaacgatcgccacatacccgactcgcccttcaaggtgtacgtctct
ccggatgcgggggatgcccacaagctcgaggtgcagcagttcccgcagggcaacatccag
gcggatgccccctaccagtttatggtacgcaagaacggagccaagggcgatctggatgcc
agaattgtggcgccatccggcaccgacgacgattgcttcatccaggcgatcgacagcgag
atgacctcggtgcgcttctatccacgcgagaacggtatccatgccatccacgtcaagttc
aacggcgtccacatacccgactcccccttcagaatcaaggtcggcaagaatgtggctgac
ccagccgctgtccatgccaccggcaacggcctggaagaggtcaagactggacacaaggcc
gatttcattatcaacacctgcaacgccggcgttggcacgctccacgtctccatcgatggc
ccctccaaggtggccatggactgcacagaggtcgaggagggctacaaggtccgctacact
cccctgctgcccggcgagcactacatcacggtcaaatacaacaacgtgcatattgtggga
tcgccattcaaggtggatgccgttggcgataagctggccgacgagggtgcccaggagacg
tcgaccgtcatcctcgagactgtgcagaaggtggccaagggtggcaagaacaccggcgtc
catctgcccaacttcaagtccgatgccagcaaggtggtgcccaagggcatgggcctgaac
agggcctacattggcaagcagaatcagttcagcatctgtgccaccgatgcgggcaacaac
atcttgtacgtcggcatgtacggaccgaagggaccctgcgaggagttccacgtcaagcat
gctggccacaacaactacaatgtgcagtatctggtgcgcgatcgcggacagtatgtgctg
ctgatcaaatggggcgaggagcatatacccggctccccattccagatcgatgtctag

DBGET integrated database retrieval system