KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26941Help
Entry
Dpse_GA26941      CDS       T01032                                 

Definition
GA26941 gene product from transcript GA26941-RA (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dpse_GA26941
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dpse_GA26941
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dpse_GA26941
Lipid biosynthesis proteins [BR:dpo01004]
 Desaturase
  First
   Dpse_GA26941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 337 aa AA seqDB search
MHKQSQKNVGQDTSSLGSEFKKRDAIWPLVLFYIHVNILGLYGIYVLVVSAAWSTILFTA
LLTLLGTMGSTVGVHRLWAHGTFTASKPLRLFLMLCQTTAGQGSIYSVVQAHRLHHEKFQ
QDEDPYYSKHSFLYAQVRGGLLKYSPQQEELLKDVDMSDLESDSIVMFQKRFYVLLYIFF
NILLSVNTPFQYFGDTLSASMFVGFWLRSLIVINVGNLVNSAHFVWSIHKGFKPTDSNSI
FLITKSYWPQFHYLLPRDYQSGEFGDYASGLGASVIRVFAALDWAKDLRTVGSVAVRQGL
SRAVETGRPIVECIEEQVRLEENALPANHFLNREKFM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagcagagccagaagaatgtgggccaggataccagctccttggggagtgagttc
aagaagcgggacgccatctggcccctggtgctgttctacatccacgtgaacattctcggc
ctctacggaatctacgtgctggtggtgagcgccgcgtggtccactattttattcacggca
ctcctgacactcctgggcacaatggggtcgaccgtgggtgtgcatcggctgtgggcccat
ggaacgttcacggcatcgaagccgctgcggctcttcctcatgctctgccagacgacggcc
ggtcagggctccatttacagtgtcgtccaagcccatagacttcaccacgaaaagttccag
caggacgaggatccctactacagcaagcacagcttcttgtacgcccaagtacgcggtggt
cttctcaagtactcgccccagcaggaggagctcttgaaggacgtggacatgtcggatctt
gagagtgactcgatagtcatgttccagaagcgcttctacgttctgctgtacatattcttc
aacattcttctgtcggtgaacaccccctttcagtacttcggggacaccctgtccgcctcc
atgttcgtgggcttctggctgcgcagcctaatcgtgattaacgtgggcaacctagtgaac
tccgcccactttgtgtggagcatccacaaggggttcaagcccaccgactccaacagcatc
ttcctcattacgaaaagctactggccccagttccactacctcctgccccgggactaccag
agcggcgagtttggcgactacgcgagcggcctgggggccagtgtgatccgcgtctttgcg
gccctcgactgggccaaggatctgcgcaccgtcggatcggtagccgtgcgccagggcctg
tcccgagcggtggagactggccgtccgattgtcgagtgcattgaggaacaggtgcgcctc
gaggagaacgctctgcccgccaatcatttcctcaatcgcgagaagttcatgtga

DBGET integrated database retrieval system