KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27156Help
Entry
Dpse_GA27156      CDS       T01032                                 

Definition
GA27156 gene product from transcript GA27156-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dpse_GA27156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESTDDRVNFRQFMNVLAHFRPLRDNKQSMLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
TKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaagtcatcactgttcctccggaacgaggagatagcgcagattcaggaggaa
actggttttactcccaaccaaatcgagagattgtactcgcgcttcacgtcgttggatcgc
aacgactgcgggaccctctcccgcgaggacctgatgcggatcccggagctggccatcaat
ccgctgtgcgagcgcatcgtccactcgttcttcgccgagagcaccgacgatcgggtgaac
tttcggcagttcatgaacgtgctggcccacttccgtccgctgagggataacaagcagagc
atgctcaacagccgggaggagaagctgaagttcgccttcaagatgtacgacctcgatgac
gacggcgtgattagccgggacgagctgctctccattctgcacatgatggtgggcgccaac
atcagccaggaccagctggtcagcattgcggagcgcacaatcctggaggcagacctctgc
tgccagggcaagatatcgttcgaggacttctgcaaggccctagaccgcaccgacgtcgac
acaaagatgtccataaggtttctcaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system