KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27397Help
Entry
Dpse_GA27397      CDS       T01032                                 

Definition
GA27397 gene product from transcript GA27397-RA (EC:3.5.1.-)
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dpse_GA27397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 436 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLDKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYELGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTRGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIDNDLPITEYYEFFGPDFTLHPEINSRQDNANSKQYL
EMIVKHVYENLKMCQHSPSVQMVQTPPDMDIEELRNKEETDPDVRISQTDDDKSVEAKNE
FYDGDQDQDKPDSAES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgaagggtttcctacttctataacgccgatgtgggtaactttcattatggc
gcggggcacccgatgaagccgcagcggctggcagtgacccatagtctggtgatgaactat
ggccttgacaagaaaatgaagatatacaggccatacaaagccagcgcccaggacatgctc
aggtttcacagtgacgagtacatagcctacctacagcaggtgaccccgcagaacattcaa
tgcaattctgtggcctataccaagtacctggcgcactttagtgtgggcgaagattgcccc
gtcttcgatggcctctttgacttttgcgccatgtacacaggcgcatcgctggagggtgcc
caaaagctgaatcacaatcatagcgacatctgcatcaactggtcgggcggcctgcaccat
gccaaaaagtttgaggcatcgggtttctgctatgtaaatgacatcgtgattggcattttg
gagctgctgaagtatcatccgcgtgtgctgtacatcgacatcgatgtgcatcatggggat
ggggtgcaggaggccttctatctcacagatcgcgtgatgacggcctcgtttcacaagtac
ggaaattacttctttccgggaacgggcgatatgtatgagctgggggcggagtctggtcga
tactacagcgtgaatgtgccactcaaggagggcattgacgatcagagctacttccaggtc
ttcaaacccatcatctcggccatcatggacttctatcggcccacggcaatcgtcctgcaa
tgcggtgcagattcactggcgggggatcggctgggctgcttctcgttgagcacgcggggc
catggcgagtgcgtgaagtttgtcaaggaactgaatgttcccaccttggtggtgggcggc
ggcggctatacgctgcgcaacgtggcccgctgctggacgcacgagacctcgctgctggtg
gatcaggacattgacaacgatctgcccatcacggagtactacgagttctttgggccggac
tttaccctacatccagagattaactcgcggcaggacaatgccaattcgaaacagtatttg
gagatgattgtgaagcatgtatatgagaacctgaaaatgtgccagcactcgcctagcgta
cagatggtgcagacgccgcccgatatggatatcgaggagctgcgtaacaaggaggagacg
gatcccgacgtgaggatatctcaaacagatgatgacaaaagtgtggaggcgaagaacgag
ttctacgatggggatcaggatcaggacaagcctgattcggcggagagttga

DBGET integrated database retrieval system