KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27609Help
Entry
Dpse_GA27609      CDS       T01032                                 

Definition
GA27609 gene product from transcript GA27609-RA
Orthology
K11252  
histone H2B
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA27609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactagtggaaaggcagccaaaaaggctggaaaggctcagaagaacatt
accaagaacgacaagaagaagaagcgcaagaggaaggagagctatgccatctatatttac
aaagttctgaagcaagtccatcctgacactggtatttcgtcgaaagcgatgagcatcatg
aacagctttgtaaatgacatcttcgagcgcattgctgccgaggcgtctcgcttggctcat
tacaacaagcgctcaaccatcaccagtcgggaaatccaaacggctgtgcgcctgctgctg
ccgggagagctggccaagcacgctgttagtgagggaaccaaggctgtcaccaagtacacc
agctccaagtaa

DBGET integrated database retrieval system