KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27611Help
Entry
Dpse_GA27611      CDS       T01032                                 

Definition
GA27611 gene product from transcript GA27611-RA
Orthology
K11252  
histone H2B
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactagtggaaaggcagccaaaaaggctggaaaggctcagaagaacatt
accaagaacgacaagaagaagaagcgcaagaggaaggagagctatgccatctatatttac
aaagttctgaagcaagtccatcctgacactggtatttcgtcgaaagcgatgagcatcatg
aacagctttgtaaatgacatcttcgagcgcattgctgccgaggcgtctcgcttggctcat
tacaacaagcgctcaaccatcaccagtcgggaaatccaaacggctgtgcgcctgctgctg
ccgggagagctggccaagcacgctgttagtgagggaaccaaggctgtcaccaagtacacc
agctccaagtaa

DBGET integrated database retrieval system