KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27611Help
Entry
Dpse_GA27611      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Chromosome and associated proteins [BR:dpo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dpse_GA27611
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA27611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6903937
NCBI-ProteinID: XP_002136580
FlyBase: FBgn0248976
UniProt: B5DUL5
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagactagtggaaaggcagccaaaaaggctggaaaggctcagaagaacatt
accaagaacgacaagaagaagaagcgcaagaggaaggagagctatgccatctatatttac
aaagttctgaagcaagtccatcctgacactggtatttcgtcgaaagcgatgagcatcatg
aacagctttgtaaatgacatcttcgagcgcattgctgccgaggcgtctcgcttggctcat
tacaacaagcgctcaaccatcaccagtcgggaaatccaaacggctgtgcgcctgctgctg
ccgggagagctggccaagcacgctgttagtgagggaaccaaggctgtcaccaagtacacc
agctccaagtaa

DBGET integrated database retrieval system