KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27711Help
Entry
Dpse_GA27711      CDS       T01032                                 

Definition
(RefSeq) GA27711 gene product from transcript GA27711-RA (EC:3.4.19.12)
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA27711
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA27711
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C67
   Dpse_GA27711
Ubiquitin system [BR:dpo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dpse_GA27711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 526 aa AA seqDB search
MNRFNGMYGHTISDYQRLIEIPGTELAIGSLVEVSDSGVCGDVYGVIRWIGIPPGISKNV
LVGIELEDEPSLKNIPLSDGSYNGLRFFTCHQGRAIFVTSDRCKTDRRFTDKDSYHVGNK
ITNNQEINFGAVACPSISGSVPPLRIHSSDELQKICGKFKGIQGHHNSCYLDATLFSMFT
FTSVFDSILYRSPGPKDIRNYRDVQKVLRDEIVNPLRKQLFVRSDSVMKLRELLDQLSSV
SGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVDKDEKLTLPTVQQLFEQ
SFHSSNIKLKEVPSCFIIQMPRFGKSYKMYPRILPSQVLDVTDIIENSPRQCFLCGKLAE
YECNECFGSLQVGQVSGLECTAFCQQCLVTFHMHAKRNNHVPTKICIPKDFRIMADHMVV
PRVYMELFSVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEMTCVPELT
QWLSDEGARSINETSPNDKVLPDHAKRIFCDAYMCLYQSTDTMMYH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatttaacggaatgtacggtcacacaatttcagattatcaacgcctgattgaa
ataccaggaacagagcttgcaattggctccctcgtggaagtatctgattctggcgtgtgt
ggagatgtgtatggtgtaattagatggattggtatacctccaggaatttctaaaaacgta
cttgttggaatagagcttgaagacgaaccttccttgaagaacattccattgtcagatgga
agttacaatggccttcgcttttttacgtgtcaccaaggtcgggctatttttgtaacgtcc
gacaggtgcaaaactgatcgccgattcaccgataaagacagctaccatgtaggaaacaag
atcactaacaatcaggagataaacttcggtgccgtcgcgtgcccttctatttctggttca
gtaccgccactgcgaatacatagttcggatgaactccagaaaatttgtggaaaattcaag
ggaatacaaggacatcataactcttgctatcttgatgcgacactattttcgatgttcact
tttactagtgtgtttgattctatactgtaccgatctccaggacccaaagatattcggaat
tacagagatgttcaaaaggttttgcgggatgaaattgttaatccattgagaaaacaatta
tttgtacgatctgacagcgttatgaagctgcgtgaactattagaccaactcagttctgta
agtggtctcacatgcgaggaaaaagatcctgaagagttcctgaacagtttactatcacaa
attatgcgcgtcgaaccattcttaaaacttagctccggacaagactcatatttttatcaa
ctgtttgtggataaagatgaaaaactaacattaccaactgtccagcaactttttgaacaa
agctttcattcgtcgaatatcaaactaaaggaggttccctcttgttttattattcagatg
cctcgttttggaaaaagttacaaaatgtatccaagaattttaccctcgcaagttctagat
gtgacagacataattgaaaactctcctcgacagtgctttctgtgtggaaaactagctgaa
tatgaatgtaatgaatgttttggaagtctacaagtcggtcaggtctcaggtcttgagtgt
acagccttttgtcaacaatgccttgttacatttcatatgcatgcaaaaaggaataatcac
gtgcctacaaaaatatgtattcccaaggacttcagaattatggctgatcatatggtagta
ccacgagtgtacatggaactattttcagttgtttgtatagaaacatctcattatgtagcg
tttgtaaaatcaggttctgggccagatgcaccatggtgttttttcgattcaatggctgat
agaaagggtgaacagaatggatataacataccggaaatgacatgtgttcccgaattaaca
cagtggctttccgatgaaggtgcgcgctctattaatgaaacatcacctaatgataaagtt
ctacctgatcacgccaagcgtattttttgcgatgcctatatgtgtctgtatcaaagcaca
gacactatgatgtaccattaa

DBGET integrated database retrieval system