KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27711Help
Entry
Dpse_GA27711      CDS       T01032                                 

Definition
GA27711 gene product from transcript GA27711-RA (EC:3.1.2.15)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA27711
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C67
   Dpse_GA27711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 520 aa AA seqDB search
MYGHTISDYQRLIEIPGTELAIGSLVEVSDSGVCGDVYGVIRWIGIPPGISKNVLVGIEL
EDEPSLKNIPLSDGSYNGLRFFTCHQGRAIFVTSDRCKTDRRFTDKDSYHVGNKITNNQE
INFGAVACPSISGSVPPLRIHSSDELQKICGKFKGIQGHHNSCYLDATLFSMFTFTSVFD
SILYRSPGPKDIRNYRDVQKVLRDEIVNPLRKQLFVRSDSVMKLRELLDQLSSVSGLTCE
EKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVDKDEKLTLPTVQQLFEQSFHSSN
IKLKEVPSCFIIQMPRFGKSYKMYPRILPSQVLDVTDIIENSPRQCFLCGKLAEYECNEC
FGSLQVGQVSGLECTAFCQQCLVTFHMHAKRNNHVPTKICIPKDFRIMADHMVVPRVYME
LFSVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEMTCVPELTQWLSDE
GARSINETSPNDKVLPDHAKRIFCDAYMCLYQSTDTMMYH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtacggtcacacaatttcagattatcaacgcctgattgaaataccaggaacagagctt
gcaattggctccctcgtggaagtatctgattctggcgtgtgtggagatgtgtatggtgta
attagatggattggtatacctccaggaatttctaaaaacgtacttgttggaatagagctt
gaagacgaaccttccttgaagaacattccattgtcagatggaagttacaatggccttcgc
ttttttacgtgtcaccaaggtcgggctatttttgtaacgtccgacaggtgcaaaactgat
cgccgattcaccgataaagacagctaccatgtaggaaacaagatcactaacaatcaggag
ataaacttcggtgccgtcgcgtgcccttctatttctggttcagtaccgccactgcgaata
catagttcggatgaactccagaaaatttgtggaaaattcaagggaatacaaggacatcat
aactcttgctatcttgatgcgacactattttcgatgttcacttttactagtgtgtttgat
tctatactgtaccgatctccaggacccaaagatattcggaattacagagatgttcaaaag
gttttgcgggatgaaattgttaatccattgagaaaacaattatttgtacgatctgacagc
gttatgaagctgcgtgaactattagaccaactcagttctgtaagtggtctcacatgcgag
gaaaaagatcctgaagagttcctgaacagtttactatcacaaattatgcgcgtcgaacca
ttcttaaaacttagctccggacaagactcatatttttatcaactgtttgtggataaagat
gaaaaactaacattaccaactgtccagcaactttttgaacaaagctttcattcgtcgaat
atcaaactaaaggaggttccctcttgttttattattcagatgcctcgttttggaaaaagt
tacaaaatgtatccaagaattttaccctcgcaagttctagatgtgacagacataattgaa
aactctcctcgacagtgctttctgtgtggaaaactagctgaatatgaatgtaatgaatgt
tttggaagtctacaagtcggtcaggtctcaggtcttgagtgtacagccttttgtcaacaa
tgccttgttacatttcatatgcatgcaaaaaggaataatcacgtgcctacaaaaatatgt
attcccaaggacttcagaattatggctgatcatatggtagtaccacgagtgtacatggaa
ctattttcagttgtttgtatagaaacatctcattatgtagcgtttgtaaaatcaggttct
gggccagatgcaccatggtgttttttcgattcaatggctgatagaaagggtgaacagaat
ggatataacataccggaaatgacatgtgttcccgaattaacacagtggctttccgatgaa
ggtgcgcgctctattaatgaaacatcacctaatgataaagttctacctgatcacgccaag
cgtattttttgcgatgcctatatgtgtctgtatcaaagcacagacactatgatgtaccat
taa

DBGET integrated database retrieval system