KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28380Help
Entry
Dpse_GA28380      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03259  
translation initiation factor 4E
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA28380
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dpse_GA28380
Messenger RNA biogenesis [BR:dpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dpse_GA28380
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dpse_GA28380
Translation factors [BR:dpo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dpse_GA28380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 227 aa AA seqDB search
MASAQGKGGVEENPKQEQKQQDKPKEQTNGEKEKDTTKGPAAACPRHSRHPLENVWTLWY
LENDRSKHWKDMLTEVAKIDSVETFWSLYYTIRPPSELKVGCDYSMFKLGIKPMWEDEAN
SKGGRWLISVNKNSKAELDRLWLEILLMMTARIFENSEEICGAVINIRSKNNKISVWTAN
GSNEAAILEIGQKLKLFLRLQSNNLQYQLHSDAMCKSNSSVKSIYTV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgctcaagggaaaggcggagtggaggagaaccccaagcaggagcagaagcag
caggataagccgaaggagcagaccaatggtgagaaggaaaaggacaccaccaaagggccg
gcggcagcatgcccgcgacacagccgccatccgctggagaacgtgtggaccctgtggtac
ttggagaacgatcgcagcaagcactggaaggacatgctcaccgaagtcgcgaagatcgac
agcgtggagaccttctggagcctgtactacaccatccggccgccatcggagctgaaggtc
ggatgcgactactccatgttcaagctgggcatcaaacccatgtgggaggacgaagctaac
agcaagggcggccgctggctgatcagcgtcaacaagaactccaaggccgaactggatcgc
ctctggctggagatactcctcatgatgacggcgcgcatcttcgagaactccgaggagatc
tgcggggcagtgatcaatattcgatccaaaaacaataagatctccgtttggactgccaac
gggagcaacgaagcagccattctggagattggccagaagctgaagctgttcctccgcctg
cagtcgaacaatctgcagtaccagctgcactcggacgccatgtgcaagtccaattcgagc
gtcaagtcgatctacaccgtctaa

DBGET integrated database retrieval system