KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28383Help
Entry
Dpse_GA28383      CDS       T01032                                 

Definition
(RefSeq) GA28383 gene product from transcript GA28383-RB
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dpse_GA28383
   04068 FoxO signaling pathway
    Dpse_GA28383
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dpse_GA28383
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dpse_GA28383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 332 aa AA seqDB search
KCLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLY
QILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYY
RAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMR
HACEGARTHMLRRAPKPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPY
LDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPFDDLWERKLTSVQQVKEEMAQVQ
LPSSCKTGRGAAAMHQSAEWGAFKSLLQVKIL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
aaatgcttgtgctttttcaagcacgagaatgttctttcggccctggacatcttgcagccg
ccacatttggatttctttcaggaaatctatgtgataacggagctgctgcaatcggatctg
cacaagataatcgtgtcgccgcagcacctatccgccgaccacatcaaggtgttcctgtac
cagatactgcggggcctcaagtatctgcactcggcccgcatcctgcatcgcgacatcaag
ccgggcaacctcctggtcaactcgaactgcgtgctcaagatatgcgacttcgggctggcc
cgcgtggaggagccggaccaggcgaagcacatgacccaggaggtggtcacccagtactac
cgcgccccggagatcctgatgggggcgcggcactactcgtcggcggtggacgtgtggtcg
gtgggctgcatattcggggagctgctcggccggcgcatcctgttccaggcgcagaacccc
gtccagcagctggagctgatcacggagctgctgggcacccccaccatggaggacatgcgg
cacgcctgcgagggcgcccggacccacatgctgcggcgcgcccccaagccgccctccttc
tcggtgctgtacaccctcagctcccatgccacacacgaggcggtgcacctgctctgccag
atgctggtcttcgatccggacaagcgaatctccgtcacagacgccctggcgcatccgtat
ctggatgaaggacggctgcgctaccactcgtgcatgtgcaaatgctgcttcactacctca
gccgggatgcgccagtacacagccgacttcgagccctccgccggccagcccttcgacgat
ctatgggagcgcaagctcacctccgtgcagcaggtcaaggaggagatggcacaagttcaa
ttgccgagcagctgcaaaacgggtcggggtgccgctgctatgcatcaatccgcagagtgg
ggggccttcaagagcttgctgcaggtcaaaattttgtaa

DBGET integrated database retrieval system