KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28568Help
Entry
Dpse_GA28568      CDS       T01032                                 

Definition
GA28568 gene product from transcript GA28568-RA
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1997 aa AA seqDB search
MVDCSPEELTTTPSPPKTSTTTIRPSPAEPSSMEPSTTEPSPESSTEPSSSSSEEPLSTE
PSPESSTEPNSSSSEEPLSTEPSPVSSTEPNSSSSAEPSSTEPSPESSTEPNSSSSEEPS
STEPSPESSTEPSNSSSEEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPNSSSSA
EPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSSTEPSLESST
EPNSSSSEEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPNSSSSEEPSSTERSPE
SSTEPSNSSSEEPSSTEPSSTEPSPESSTEPSNSSSKEPSSTEPSSTEPSPESSTEPNNS
SSEEPSSTEPSPESSTEPNSSSSEEPSSTERSPESSTEPSNSSSEEPSSTEPSSTKPSPE
SSTEPSNSSSEEPSSTEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSNSSSEEP
PSTEPSSTEPSPESSTEPNNSSSEEPSSTKPSPESSTEPNSSSSEEPSSTERSPESSTEP
SNSSSEEPTSTEPSSTEPSPESSTEPNNSSSEEPSSTEPSPESSTEPNSSSSEEPSSTEP
SPESSTEPNSSSSEEPSSTERSPESSTEPSNSSSEEPTSTEPSSTEPSPESSTEPNNSSS
EEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSN
SSSEEPSSTGPSSTEPSSTEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSNSSS
EQPSSTEPSPESSTEPSNSSSEEPPSTEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESS
TEPSNSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSSTEPSPESSTEPNSSSSEEPSS
TEPSPESSTEPSNSSSEEPSSTGPSSTEPSSTEPSSTEPSPESSTEPNSSSSEEPSSTEP
SPESSTEPSNSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSSTEPSPESSTEPNSSSS
EEPSSTEPSPESSTEPSNSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSSTEPSPESS
TEPNSSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSPESSTEPSNSSSEEPSSTGPSS
TAPSSTEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSNSSSEEPSSTEPSPESS
TEPSNSSSEEPSSTEPSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPNSSSSEEPSS
TEPSPESSTEPSSSSSEEPSSTEPSSTEPSPESSTEPNNSSSEEPSSTEPSPESSTEPNS
SSSEEPSSTEPSPESSTEPNSSSSAEPSSTEPSPESSIEPNSSSSEEPSSTEPSPESSTE
PSSSSSEETSSTEPSSTEPSPESSTEPNNSSSEEPSSTEPSSTEPSPESSTEPNSSSTEE
PSSTEPSPESSTEPNSSSSEEPSSTEPSPESSTEPSSSSSEEPSSTEPSSTEPSPESSTE
PNTSSSEEPSSTEPSPESSIEPNSSSSEEPSSTEPSPESSTEPNNSSSEEPSSTEPSSTE
PSPESSTEPNSSSSEEPSSTEPSPESSTEPNNSSSEEPSSTEPSPESSTEPNSSSSEEPS
STEPSPESSTEPNSSSSAEPSSTEPSPESSIEPNSSSSEEPSSTEPSPESSTEPNNSSSE
EPSSTEPSPESSTEPNNSSSEEPSSTEPSPESSTEPSNSSSEEPLSTEPLSTEPSPESST
EPSNSSSEGTTSSTEKSAESSAVIEAAPSLPVRRPIKPVLMSNHPAVYGGKDETQSSVGS
KQLQHNRVLSTLSGGSSQFQERTDCSFLPTGAFLRDPTSCNKFYVCVNGLAVPRRCPSIL
YFDIKKKVCNFPSLVDCSLVSKGAPVSVVKTLSQHSGLIGSSSSQEVEQEPILECSSLPN
GELVRALNSCSKFYVCANGLAISRQCPKGLYFDITRKICTFPSLVDCSIVESSRKQVKRK
PAQGRDGSASPVKLHRK
NT seq 5994 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactgctctcccgaagaattgaccacgacaccgtccccacctaaaacttcgaca
acgacaattaggcccagccctgcagaaccatcatccatggaaccatcaacaaccgaacca
tctccggagagctcaacagagccaagtagctccagctcagaggaaccattgtccacggaa
ccttctccggagagctcaacagagccaaatagctccagctccgaggaaccattgtccacg
gaaccttctccggtgagctcaacagagccgaatagctccagctctgcggaaccatcgtcc
acggaaccttctccggagagctcaacagagccaaatagctccagctcagaggaaccatcg
tccacggaaccttctccggagagctcaacagagccaagtaactccagctccgaggaacca
tcttccacggaaccttctccggagagctcaacagagccaaatagctccagctcagaggaa
ccatcttccacggaaccttctccggagagctcaacagagccaaatagctccagctctgcg
gaaccatcgtccacggaaccttctccggagagctcaacagagccaaatagctccagctcc
gaggaaccatcttccacggaaccttctccggagagctcaacagagccaagtaactccagc
tccgaggaaccatcatcgacggaaccctcgtccacggaaccttctctggagagctcaaca
gagccaaatagctccagctccgaggaaccttcgtccacggaaccttctccggagagctca
acagagccaaatagctctagctccgaggaaccatcgtccacggaaccttctccggagagc
tcaacagagccaaatagctccagctcagaggaaccatcttccacggaacgttctccggag
agctcaacagagccaagtaactccagctccgaggaaccatcatcgacggaaccctcgtcc
acggaaccttctccggagagctcaacagagccaagtaactccagctccaaggaaccatca
tcgacggaaccctcgtccacggaaccttctccggagagctcaaccgagccgaataactcc
agctccgaggaaccctcttccacggaaccttctccggagagctcaacagagccaaatagc
tccagctcagaggaaccatcttccacggaacgttctccggagagctcaacagagccaagt
aactccagctccgaggaaccatcatcgacggaaccctcgtccacgaaaccttctccggag
agctcaacagaaccaagtaactccagctccgaggaaccatcatcgacggaaccctcgtcc
acggaaccttctccggagagctcaaccgagccgaatagctccagctccgaggaaccatcg
tccacggaaccttctccggagagctcaacagagccaagtaactccagctccgaggaaccg
ccatcgacggaaccatcgtccacggaaccttctccggagagctcaaccgagccgaataac
tccagctccgaggaaccctcgtccacaaaaccttctccggagagctcaacagagccaaat
agctccagctcagaggaaccatcttccacggaacgttctccggagagctcaacagagcca
agtaactccagctccgaggaaccaacatcgacggaaccctcgtccacggaaccttctccg
gagagctcaaccgagccgaataactccagctccgaggaaccctcgtccacggaaccctct
ccggagagctcaacagagccaaatagctccagctcagaggaaccatcgtccacggaacct
tctccggagagctcaacagagccaaatagctccagctcagaggaaccatcttccacggaa
cgttctccggagagctcaacagagccaagtaactccagctccgaggaaccaacatcgacg
gaaccctcgtccacggaaccttctccggagagctcaaccgagccgaataactccagctcc
gaggaaccctcgtccacggaaccctctccggagagctcaacagagccaaatagctccagc
tcagaggaaccatcgtccacggaaccttctccggagagctcaacagagccaaatagctcc
agctcagaggaaccatcttccacggaaccttctccggagagctcaacagagccaagtaat
tccagctctgaagaaccatcgtccacgggaccctcgtccacggaaccctcgtccacggaa
ccatcgtccacggaaccttctccggagagttcaacagagccaaatagctccagctcagag
gaaccatcttccacggaaccttctccggagagctcaacagagccaagtaactccagctcc
gagcaaccatcttccacggaaccttctccagagagctcaacagagccaagtaactccagc
tccgaggaaccgccatcgacggaaccatcgtccacggaaccttctccggaaagctcaaca
gagccaaatagctccagctcagaggaaccatcttccacggaaccttctcctgagagctca
acagagccaagtaactccagctcagaggaaccatcttccacggaaccttctccagagagc
tcaacagagccaagtaactccagctccgaggaaccatcatcgacggaaccatcgtccacg
gaaccttctccggaaagctcaacagagccaaatagctccagctcagaggaaccatcttcc
acggaaccttctccggagagctcaacagagccaagtaattccagctctgaagaaccatcg
tccacgggaccctcgtccacggaaccctcgtccacggaaccatcgtccacggaaccttct
ccggagagttcaacagagccaaatagctccagctcagaggaaccatcttccacggaacct
tctcctgagagctcaacagagccaagtaactccagctcagaggaaccatcttccacggaa
ccttctccagagagctcaacagagccaagtaactccagctccgaggaaccatcatcgacg
gaaccatcgtccacggaaccttctccggaaagctcaacagagccaaatagctccagctca
gaggaaccatcttccacggaaccttctcctgagagctcaacagagccaagtaactccagc
tcagaggaaccatcttccacggaaccttctccagagagctcaacagagccaagtaactcc
agctccgaggaaccatcatcgacggaaccatcgtccacggaaccttctccggaaagctca
acagagccaaatagctccagctcagaggaaccatcttccacggaaccttctcctgagagc
tcaacagagccaagtaactccagctcagaggaaccatcttccacggaaccttctccggag
agctcaacagagccaagtaattccagctctgaagaaccatcgtccacgggaccctcgtcc
acggcaccctcgtccacggaaccatcgtccacggaaccttctccggagagttcaacagag
ccaaatagctccagctcagaggaaccatcttccacggaaccttctcctgagagctcaaca
gagccaagtaactccagctcagaggaaccatcttccacggaaccttctccagagagctca
acagagccaagtaactccagctccgaggaaccatcatcgacggaaccatcgtccacggaa
ccttctccggagagctcaacagagccaaatagctccagctccgaggaaccctcgtccacg
gaaccttctccggagagctcaacggagccaaatagctccagctccgaggaaccatcgtcc
acggaaccttctccggagagctcaacagaaccaagtagctccagctccgaggaaccatca
tcgacggaaccctcgtccacggaaccttctccggagagctcaacagagccgaataactcc
agctctgaggaaccatcgtccacggaaccttctccggagagctcaacagagccaaatagt
tccagctctgaggaaccctcgtccacggaaccttctccggagagctcaaccgagccgaat
agctccagctctgcggaaccatcgtccacggaaccttctccggagagctcaatagagccg
aatagctccagctccgaggaaccctcgtccacggaaccttctccggagagctcaacagaa
ccaagtagctccagctccgaggaaacatcatcgacggaaccctcgtccacggaaccttct
ccggagagctcaacagagccgaataactccagctctgaagaaccatcgtccacggaaccc
tcgtccacggaaccttctccggaaagctcaacagagccaaatagctccagcacagaggaa
ccatcttccacggaaccttctccggagagctcaacagagccaaatagctccagctccgag
gaaccatcgtccacggaaccttctccggagagctcaacagaaccaagtagctccagctcc
gaggaaccatcatcgacggaaccctcgtccacggaaccttctccggagagctcaacagag
ccgaatacctccagctctgaagaaccatcgtccacggaaccttctccggagagctcaata
gagccgaatagctccagctccgaggaaccctcgtccacggaaccttctccggagagctca
acagagccgaataactccagctccgaggaaccatcatcgacggaaccctcgtccacggaa
ccttctccggagagctcaaccgagccgaatagctccagctccgaggaaccatcgtccacg
gaaccttctccggagagctcaacagagccgaataactccagctctgaggaaccatcgtcc
acggaaccttctccggagagctcaacagagccaaatagttccagctctgaggaaccctcg
tccacggaaccttctccggagagctcaaccgagccgaatagctccagctctgcggaacca
tcgtccacggaaccttctccggagagctcaatagagccgaatagctccagctccgaggaa
ccctcgtccacggaaccttctccggagagctcaacagagccgaataactccagctctgag
gaaccctcgtccacggaaccttctccggagagctcaacagagccgaataactccagctct
gaggaaccatcgtccacggaaccttcaccggagagctcaacagagccaagtaactccagc
tccgaggaaccattatcgacggaacccttgtccacggaaccttctccggagagctcaacc
gagccaagtaactcaagctctgaaggaacaacatcatcaaccgagaaatcagccgaaagc
tctgccgtaatcgaagcggctccatcattgcccgtccgtagaccgatcaaaccagttttg
atgtccaaccatccagctgtgtatggtgggaaggacgaaacacagagttcggtgggaagt
aaacaactgcagcataatcgtgtgctgagcactttgtcagggggttcttctcagtttcaa
gaaagaacagactgcagtttcctccccactggagccttcctaagggatcccacgtcgtgc
aacaaattctatgtgtgtgtaaatggattggccgttccccggcgctgtcctagtattctc
tactttgacatcaagaagaaggtgtgcaatttccccagcctcgtggactgctctctggtg
tccaaaggtgccccggtctccgtagtcaagacactttcgcagcactcgggtctcattggg
tcatcatccagtcaggaagtggaacaggaaccgatccttgaatgcagctcgcttccaaac
ggtgaacttgtccgggctctgaattcatgcagcaaattctatgtctgcgccaatggcctc
gccatatcccgtcaatgtccgaagggtctgtatttcgacatcacaaggaagatctgcacc
ttccccagtctcgtggattgctcgatagtcgagtcgagtcgaaagcaagtaaaacggaaa
cctgcccaaggtcgggatggaagcgcttcaccagtgaagctgcatcggaaatag

DBGET integrated database retrieval system