KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28658Help
Entry
Dpse_GA28658      CDS       T01032                                 

Definition
GA28658 gene product from transcript GA28658-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpo03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dpo04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 263 aa AA seqDB search
MQSDFHRMKNFANPKSMFKTSAPTTEGGNPAANTVAPGRPEPTPAVAVADPDAAPALTAT
LVQTKDEAKPTEAGDDVRTEHLFKHPLHNTWTLWYLENDRSKSWEDMQNEITSFDAVEDF
WSLYNHIKPPSEIKLGSDYSLFKKGIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDV
LLCLIGEAFDHSDQICGAVVNIRAKSNKISIWTADGNNEEAALEIGHKLRDALRLGRQNS
LQYQLHKDTMVKQGSNVKSIYTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgactttcacagaatgaagaactttgccaatcccaagtctatgttcaaaacc
agtgctcccaccaccgagggtggcaacccggctgccaacacagttgcccctggacgcccg
gagcccactccagcagttgctgttgccgaccctgacgcggctccggccctgactgcaact
ctagttcagactaaggatgaggccaagcctaccgaggccggtgacgatgttcgcacagag
catctgttcaagcaccctctacacaacacatggactctctggtacttggagaacgatcgt
tcaaagtcctgggaggacatgcagaatgagatcacaagctttgatgccgtcgaggacttc
tggagtctatacaaccatatcaagcctccatctgagatcaaactgggcagtgattactcg
ctcttcaagaagggaatacgccccatgtgggaggatgctgccaataagcagggcggtcgc
tgggtgatcaccctcaacaagagctcaaagaccgatttggataatttgtggctcgatgtg
ttgctgtgcctgattggagaggcctttgatcattcggatcagatttgtggtgctgtcgtt
aatattcgtgccaagagtaacaaaatctccatttggacagccgatggaaacaacgaggaa
gctgctctggagattggccacaagctgcgcgatgccttgcgtctgggacgccagaactcg
ctgcagtatcaacttcacaaggataccatggtcaagcagggatccaacgtgaaatctatc
tacacattgtaa

DBGET integrated database retrieval system