KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28770Help
Entry
Dpse_GA28770      CDS       T01032                                 

Definition
GA28770 gene product from transcript GA28770-RA
Orthology
K03099  
son of sevenless
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA28770
   04630 Jak-STAT signaling pathway
    Dpse_GA28770
   04068 FoxO signaling pathway
    Dpse_GA28770
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dpse_GA28770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 1618 aa AA seqDB search
MFSGPGSHAISYSGGISIGGGGSGLHQDCDGYDFTKNENAARWRGLFIPSLRKVLEQVHP
RVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSFPTPIDQWALKEANEAIN
SKKKKSVLPTERVHTLLQKDVLQYKIDSSVSAFLVAVLEYISADILKMAGDYVCKISHCE
ITKEDIEVVMNADRVLMDMLNQSDIKTSPLSLPAQRASATYEETVKELIHDEKQYQRDLH
MIIRVFREELVKIVSDPKELEPIFSNIMDIYEVTVTLLGSLEDVIEMSQEQNAPWVGSCF
EELAEAEEFDVYKKYAHDVTSQASRDALTNLLSKPEASSLISAGHGFRDAVKYYLPKLLL
VPICHAFVYFDYIKHLMDLSSSQDDIESFEQVQGLLHPLHCDLEKVMGSVSKERLVPVSG
RVRRQMAIERTRELQLKVEHWDDKDVGQNCNEFIREDSLSKLGSGKRIWSERKVFLFDGL
MVLCKANTKKQTPSAGATAYDYRLKEKFFMRRVEIIDRADSEELKNSFELVTRMQPAIVL
TAKNAQHKHDWMADLLMVNTKSMLDRILDSILQDIERKHPLRMPSPEIYKFAVPDSGENI
VLEERESAGVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLQLLIERF
NIPDPSLVYQDAAFGPGALGGGGGGDKEHKNSQREDWKRYRKEYVQPVQFRVLNVLRHWV
DHHFYDFEKDPTLLEKLLHFLEHVNGKSMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHD
PPPIEHHMSVPNEEITLLTLHPLELARQLTLLEFEMYKNVKPSELVGSPWTKKDKELKSP
NLLKIMKHTTNVTRWIEKSITEAENHEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMG
TASVYRLRWTFQGLPERYKKFLDECRELSDDHLKKYQERLRSINPPCVPFFGRYLTNILH
LEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQNQPYCLNEEATIRQFFEQLDPFNGLS
DKEMSDYLYNESMRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQNNNSSKLSSTASS
AAAASSAASTVAAAAAAATAAVPPTQPASVEVLPSGASIPSAGAGEQSPQHNPHAFSVFA
SVLLPDRNGSTWSGTPLHHRTTAENNEEVVVPAPHLPKKPAAHVWTNNVAMMGATASAMD
VFSPVMSDHHALPPQSLPDSNPFAVGSDTDALPSPLPKLMVSPRHETGNRSPFHGRMQYS
PTHSIASTVTLTGVSGVGAGVGPGGDLSPQMGGFYYNNAHQGQTGAVPISPHVNVPTASI
LDYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPRLNHSTGAIS
VRHSHGQSKEFASSCKSGLLLPNTSSIMIRRNSAIEKRAAAAAQQPGPNAVATAAALAGS
VMGSINTTLVTVSQSVPTEEQPPQSISPALSSSTTTSPLTPATPISPNIPSHPVESTSSG
YTHQLRLRPQQQQSQQALSYPAAYAQHHHTHHTHHPPHHHQQYQQHQQHQQHHQQQHQQH
HQQHANQLHTRSSPKEFFPIATSLEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNQE
NT seq 4857 nt NT seq  +upstreamnt  +downstreamnt
atgttttccggacccggtagccatgccattagctatagcggcgggatcagcattgggggg
ggaggcagtggcctgcaccaggattgcgatggctatgacttcacgaagaacgagaacgcg
gcgcgttggcgtggcctgttcataccctcattgaggaaggtgctagagcaggtgcatccg
cgggtgacggccaaagaagatgccctcctctatgtcgagaagctgtgtctgcgtctgttg
gccatgctctgcgccaagccgctgccccactcagttcaagatgtggaggagaaggtgaac
aaatcatttccaacgcccatcgaccagtgggctctcaaggaggccaacgaggcgatcaac
tcgaagaaaaagaagtccgttctgcccaccgagcgtgtacacaccctgctccagaaggat
gtgctgcagtacaaaatcgatagttcggtgtccgcctttctggtggcagtcctggaatat
atctctgcggatatactgaaaatggccggcgactatgtgtgcaaaatctcgcactgcgag
atcaccaaagaggacatcgaggtggtcatgaacgcggaccgggtcctcatggacatgttg
aatcaaagtgatattaagaccagtccgctctcactgcccgcgcagagggccagcgcgacc
tatgaggagactgtcaaggagttgatccacgacgagaagcaatatcagcgagatctccat
atgatcatacgcgtctttcgcgaggagctggtgaagattgtgtcagatcccaaggagctc
gagccaatattctccaacataatggacatctacgaggtgacggtcactctgctcggctct
ctggaggatgtcatcgagatgtcccaggagcagaacgccccctgggtgggcagctgcttc
gaggagctggcggaggctgaggaattcgatgtgtacaaaaagtatgcccacgatgtgacc
tcccaggcgtcacgggatgcgcttaccaatctcttatccaagcctgaggcctcatcctta
atttctgccgggcacggttttagagatgccgtcaagtattatctgcccaagctgctgctg
gtgcccatttgccatgctttcgtgtacttcgattacataaaacatctgatggatctcagt
tcctctcaggacgacatcgagagctttgaacaggtgcagggcctcttgcatccactccac
tgcgacctcgaaaaggtgatgggcagcgtctccaaggagcgcctggtacctgtcagtggg
cgagtgcgtcgccagatggccatcgaacggacacgagaactccagctcaaggtggagcat
tgggatgacaaggatgtgggccagaactgcaatgagtttatacgcgaggactcgctcagc
aagctgggatcgggcaagcgtatttggagcgagcgaaaagtctttctgttcgatggtctt
atggtcctgtgcaaggcaaacaccaagaagcagaccccctcggcaggggccacggcctac
gattaccggctgaaggagaagttctttatgcgtcgcgtcgagatcattgaccgggcggac
agcgaggagctgaagaacagcttcgagctagtcaccagaatgcagccggccattgtcctg
acggccaagaacgcccagcacaagcacgactggatggcagaccttctgatggtgaacacc
aagtcgatgctggaccgcatcctggacagcatactgcaggacatcgagcgcaagcatccc
ctgcgcatgcctagcccagagatctacaagttcgccgttccggatagcggggagaacatc
gtcttggaggagcgcgagagcgctggagtcccgatgatcaaaggggccacactgtgcaag
ctcatcgaacgcctcacctaccacatatatgcggaccccacctttgtgcgcaccttcctc
acgacatatcgctacttctgctcgccccagcagctgctgcagctgctgatcgaacgcttc
aacatacccgaccccagtttagtctatcaggacgctgcctttggcccgggagcccttggt
ggcggcggcgggggcgacaaggagcacaagaactcgcagcgcgaggactggaaacgctac
cgcaaggagtacgttcagccggtgcagtttcgggtgctcaacgttctgcgccactgggtg
gatcaccacttctatgactttgagaaggatcccactctgctcgagaagctgctgcacttt
ctggagcatgtgaacgggaagtcgatgcgcaaatgggtggattctgtgctcaaaattgtt
cagagaaagaacgaacaggagaaaagcaataagaagattgtgtacgcctatggccacgat
ccgccgcccattgagcaccacatgagtgtacccaacgaggagatcacactgctcaccctc
catccgttggagctggcccgtcagctcacgctgttggagtttgagatgtacaagaacgta
aagccctcggagctcgtaggatcgccctggaccaagaaggacaaggagctaaagagcccc
aatctgctgaagatcatgaagcacaccaccaatgtgacgcgttggatagagaagtccata
accgaggcggagaaccacgaggagcgcctggcaataatgcagcgggccatcgaggtcatg
atggtcatgctcgagctgaacaacttcaatggaatcctttcgattgtcgcggccatgggc
acggcgtcggtctacaggctgcggtggacattccagggattgcccgaacgctacaagaag
ttcctggacgagtgccgcgagcttagcgacgatcatctcaagaagtatcaagagcggctg
cgctccatcaatccgccttgcgtgcccttctttgggcgttacctgaccaacatcctgcac
ttggaggagggcaacccggatctgttggccaacacggagcttatcaatttctcgaagcgg
cggaaagtggccgagatcatcggcgagatccagcagtaccagaaccagccctactgcctc
aatgaggaggccaccatacggcagttcttcgagcagctcgatcccttcaacggcctctcc
gacaaggaaatgtccgactatctctacaatgagagcatgcgcatcgagccgcgtggctgc
aagacggtgcccaagtttcctcgaaaatggccgcacattccgcttaagtcgccgggcatt
aagccccgtcgccagaaccagaataataacagcagtaagttatccagcactgcttcatcg
gcggcggcagcctcatcggcggcatcaacggtagcggcagcagcagcagccgcaacagca
gctgtgcccccaactcaaccagctagcgtggaagtgctaccgagtggtgcatccattccc
agcgctggtgctggcgaacagagtccgcagcacaatccgcacgcgttctcggttttcgcc
tccgtccttctacccgatcggaatggcagcacttggagcggaacacctctgcatcatcgg
acaacagcggagaacaatgaggaggttgtggtgccggcgccacatctgcccaagaagccg
gcggcgcatgtgtggaccaacaatgtggcaatgatgggtgctacggcgtcggcgatggat
gtgtttagtccagtgatgtcggatcaccatgcgctgcccccacaatcgctgccagacagc
aacccctttgccgtaggctcagacacagatgccctgccttcgccgttgcccaagctgatg
gttagtcctcgccacgagaccggcaatcggtcaccattccatgggcggatgcaatacagt
cccacgcatagcattgccagcactgtgactctgacgggagtgagcggagtcggagccgga
gtcggacctggaggagatctcagccctcagatgggtggattctactacaacaatgcccac
cagggacagacaggggcagtgcccatctcgccgcatgtcaatgttccaacggcctcaatc
ctggactatcgagctgtgccccccccactgccgccacgtcgcaaggagcggaccgagagc
tgtgccgatatggcgcagaaacggcaggcacctgacgcaccgacattacccccgcgcgat
ggcgaactgagtcctccccccataccgccccgactcaaccattccacgggcgctatatcc
gtacgacacagccatggccagagcaaggagttcgcgagttcgtgcaagagcggcctactc
ctgcccaacacaagcagtattatgatacgcaggaactcggcgatcgagaagcgggcagca
gcggctgcccagcagcctggtccgaatgcagtggcgactgcagctgctttggcggggtcg
gtgatggggtccattaacacgacgttggtcacagtatcacagtcagtgccgactgaagag
cagcctccgcaatcgatctcgccagcactgagctcctcgacaactacatctccgctgaca
cccgcaacgcccatctccccgaacattcccagccatccagtggagagtacgtcaagcggt
tatacgcaccagcttcgtttaaggccccagcagcagcagtcgcagcaagcattgtcgtat
ccagcggcgtatgcacagcatcatcatacccaccacacgcaccatccaccccaccaccat
caacaatatcaacagcatcagcagcatcaacagcatcatcaacagcagcatcaacaacat
catcaacagcatgcaaatcaattacacacacgctcgtccccaaaggaattctttccgatt
gccacgagcctcgagggcacacccaaacttccaccaaaacctagtctaagcgctaacttc
tataacaatccagataaaggtacgatgtttctttacccaagtacaaaccaagaataa

DBGET integrated database retrieval system