KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28784Help
Entry
Dpse_GA28784      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00511  Other glycan degradation
dpo00600  Sphingolipid metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dpse_GA28784
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dpse_GA28784
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dpse_GA28784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 6902690
NCBI-ProteinID: XP_002133205
FlyBase: FBgn0250143
UniProt: B5DJY3
Position
4
AA seq 946 aa AA seqDB search
MAATGETAKAAPTMLGNGNAVFDEKLKRAEEEKEEARADEPNEITDVPRYGLKLKFGHAW
PERRIQNVRASIRQTLPLVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIGGI
GGGTIGRGFAGEFCRFQMRPGIYEYNVVQANQFIVTIKDQKGCTIFQSLLSKCSTMSRGN
NGSDPDADGEKTKCQLPNCSSRPKQPLSAWHSNIEDARCSYTGLYPRSWTEYDLSHYGVR
LVCRQVSPVIPHEYRDSSLPCAVFVWSVENVCDQERIVSITFSFKNGTGNKKQDAEGGAE
SQLISAGNAKGVAIRQKIADMPCSYNLACRVLPEISITRCPQFDPAGSGEQLWAQLKEHG
QLSEQPTGETLKTKDIGVAVCAQLALKPQASHDLEFVLAWDMPRIQFPRKMQTHMRYYTK
YFDDSGESGPKICEYALKQYPSWERLIDAWQRPILSDDTLPDWYKCAIFNQLYFISDGGT
IWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVSL
QYDFKDAIAAELSDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDWK
DLNTKFVLQVYRDYYVLNELAQSQADNASKFSSIEFIDKESLYEMYTQDNKRKNSSDEKQ
QNRKSASMYINETNGKVYLMDAIGYLKAMYGACKAIMERTIEYDKDNDGLIENTKMPDQT
YDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRFQDILEKGKRSLEEKLWNGSY
YRFDLSPSHRDSIMADQLCGHWYLKSCGFDYEIYPKENVRTALKTIYDNNVMGFHEGNIG
AANGFIANAADPSKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKTL
SERIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRALRD
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccggcgaaacagcaaaagcagcgccaacaatgctgggcaatgggaatgcc
gttttcgacgaaaagcttaagcgggcggaggaagagaaggaggaggcgcgtgccgacgag
cccaacgagatcacggacgtgccgcgctacggcctcaagctgaagttcggtcatgcgtgg
cctgagcggaggatccaaaatgtccgggcatccatccggcaaacgctgcccttggttccc
cttgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgtcgagtgtac
atggactactactacatggagaacggaaagcagatttatggcgtgcccatcggcgggata
ggcggaggcaccattggacgcggctttgcgggcgagttttgtcgcttccagatgcgtccc
ggcatctatgagtacaatgtggtgcaggccaaccagtttatagtgaccatcaaagatcag
aagggctgcaccatctttcaaagtctactctccaagtgcagcaccatgtcgaggggcaac
aacggcagcgatccggatgccgatggggagaaaactaaatgtcaactgcccaattgcagc
agccgccccaagcagccgctgagtgcctggcactccaacatcgaagacgcacggtgcagc
tacacgggcctgtacccccgctcctggaccgagtacgatctctcccactatggggttcga
ctggtgtgtcgccaggtctcgcccgtcatcccgcacgagtaccgggactccagcctgccg
tgtgctgtctttgtgtggagtgtggagaacgtgtgcgaccaggagcgcatagtctccatc
acgttctccttcaagaacggcacgggcaacaagaagcaggacgccgagggcggggccgag
tcgcagctgatcagcgcaggcaatgcaaagggtgtcgccattcgccagaagatcgccgac
atgccgtgcagctacaacctggcctgtcgcgtcctgccagagatcagcatcacgcgctgt
ccccagttcgaccccgctggcagcggagagcagctgtgggctcagctgaaggagcacggc
cagctcagtgagcagcctaccggggaaaccctgaaaaccaaagacataggcgtcgctgtc
tgcgcccaactagccctcaagccccaggcctcgcacgatctagagtttgtcctggcgtgg
gacatgcccaggattcagttccccaggaagatgcagacgcacatgcgctactacaccaaa
tactttgacgacagcggcgaatcgggaccaaagatatgcgagtatgctctgaagcagtac
cccagctgggagcgactaattgatgcctggcagcggcccatactcagcgatgatactcta
cccgactggtacaagtgcgccatattcaatcagctctactttatctcagacgggggaacc
atctggctgaagtgcgactcatcgctgggcaaggagctggcctacgacgatccgcggctg
gcctatgggcgtttcggctacttggaggggcacgagtatcggatgtacaacacctacgat
gttcacttctatgcctctccggcactggcccatctctggccaaacctgcaggtgagcctg
cagtacgacttcaaggatgccattgcagccgagctgagcgacacccgaaagatgctgtac
gacggcaaagtgatgccgcgcaaggtcaagaactgtgtgccccatgatctgggcgatccc
gatgaagaaccctttaccctgatcaattgctataacattcacgatgtaaacgattggaag
gatctcaataccaagtttgtgctgcaggtctacagggactactatgtcctgaatgaactg
gcccagtcacaagcggacaatgctagcaagtttagctccattgagttcatcgacaaggaa
agcctgtacgaaatgtacacgcaggacaacaagcgcaagaactcgtcggacgagaagcag
cagaatcgcaagtcagcctccatgtatatcaacgaaaccaatggcaaagtgtacctcatg
gatgcgattggctatctgaaggcaatgtacggggcctgtaaggccatcatggagcgaacc
attgagtatgacaaggacaacgatggtcttatcgagaacaccaaaatgccggatcagacc
tacgactcttgggtgatggacggacccagtgcgtactgctcaggcctgtggctggccgct
ctgcaggcaatgtcggccatggccaccattctagaccagccgaacgattgccttcgcttt
caggacatcctggagaagggcaagcgatctctggaggagaagctttggaacggcagctac
tatcgcttcgatctctcgcccagccatcgggactcgattatggcggatcagctgtgcggc
cattggtatttaaaatcgtgtggctttgattacgaaatctatcccaaggagaatgtgcgc
acagctctcaagacgatctacgacaacaacgtgatgggcttccacgagggcaacattggg
gcggccaacggcttcatagccaatgcggcagacccctccaagcctggccatgtggacaat
agcaatatccaagcagaggaggtgtggcccggagtggtctatgcccttgcagccaccatg
atacaggagggcatgttcgaggaagccttccagacggccggcggaatgtacaagaccctc
tcggagcgaatcggcatgaacttcgagacgcctgaggccctgtacggtgagaagcgctat
cgctccattggctacatgcggccattgagcatctggtcgatgcaggtggcattggagcgg
cgcagagcactgcgagactaa

DBGET integrated database retrieval system