KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA29010Help
Entry
Dpse_GA29010      CDS       T01032                                 

Definition
GA29010 gene product from transcript GA29010-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Ribosome [BR:dpo03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dpse_GA29010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 200 aa AA seqDB search
MLPIARGIYNGLASITRNSRGALHTASAFRGKAETAAATENEAEAVDGEEEPKSSGPDPK
DRTQVIPVETSIRYLKSVAYKETYGDDFVWSQYRRNHKGMYAPRKTRKTCIRQGKISTGN
PCPICRDEYLVLDYRNTELLEQFISPHNGEVLSYSKTGLCQKSHLRLRVAVEQARDSGLI
TYDVPFREYDYNEFYGQQKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccattgcgcgagggatatacaatggtttggctagcataacgcgcaacagccgg
ggagctttgcatacagccagcgccttcagaggcaaggctgaaacagcagcagcaacggaa
aatgaagcggaggcggtcgatggcgaagaggagccaaagagctctggtccggaccccaaa
gatcgcacccaagtgatacctgtggaaacatcaatacgttatctgaagagtgtcgcgtat
aaggagacctatggcgacgatttcgtgtggtctcaatatcggcgcaaccacaagggcatg
tatgcgccacgcaagacccgcaagacttgcattcgccaagggaaaatatccaccggtaat
ccttgtcccatttgtcgcgatgagtatctcgtcctggattaccgcaacacggaactactg
gagcagttcatttcgccgcacaatggagaggtcctcagctactcgaagacgggtctatgc
cagaaaagtcatttgcgtttgagggtggcggtggagcaggcccgggattctggcctcata
acctacgatgtgccattcagagagtatgactacaacgagttctatggccagcaaaagtcc
taa

DBGET integrated database retrieval system