KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA29320Help
Entry
Dpse_GA29320      CDS       T01032                                 

Definition
GA29320 gene product from transcript GA29320-RA (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dpse_GA29320
Enzymes [BR:dpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dpse_GA29320
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C44
   Dpse_GA29320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 563 aa AA seqDB search
MCGIFAIFSRDSKPVGTQVLHGSKHSLREMAYRQSGKQRHRGPDSTGVHVIAEDGVAMVH
ERLRIVGVERGDQPFVSNDGNVVLVANGEIYNYLELSAEIAKRLGTYKPKSDCHVILELY
EVYGEDLLSHITGMFAFALYDKRTKQVLLARDPFGIIPMYIGEDKAGNMWVASEMKCLVD
TCSKVETFTPGEARFGRVGEMRTFRHFQQSWIKELPTNPCDLKLLRSSLESAVRTHLHCD
VNFGALLSGGVDSSLIAAIATKIMREKDPYYRLKTFSVGLADAPDFKAARHVAKYIGSDH
KEIVFQIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLTRYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNCEQFHQELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPQDKIPGELNAFAEALGPLRRIEKYVLRAAFTENYLPDDVLWRQKEQFSDGVGYDWID
SIRRVATSHVGDEEFAEATRRFPFNTPTTKEAFYYRSIFEEQFPVEGAARTVVRWVPRLD
WGCPEDPSGRAQAVHQVNKDAII
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgcaatattttcaagggattcgaagcctgttggcacgcaggttctg
cacggcagcaagcatagtctgcgcgagatggcctaccgccagagtggaaagcagcggcat
cgtggccccgactctactggcgtccatgtcatcgcagaggatggtgtggccatggtccac
gaacgtctgcgcattgtgggtgtggagcggggtgaccagccgtttgtgtccaacgatggg
aacgtggtgctggtggccaacggagagatctacaactacctggagctgtcggcggagata
gcaaagcggcttggaacctacaagccgaagagtgactgtcacgtcatcctggagttgtac
gaggtctatggggaggatctactgagccacatcaccggaatgttcgccttcgccctgtac
gacaaacgcacgaagcaagtgctccttgccagggatccctttggcatcattcccatgtac
atcggcgaggataaggccggtaacatgtgggtggcctccgaaatgaagtgcttggtggac
acttgtagcaaagttgagacgtttacgccgggcgaagctcgcttcggacgcgtgggagag
atgcgaaccttccggcactttcagcaatcctggatcaaggaacttcctaccaacccttgc
gacctgaagctactccgttccagcctggagtcggcggtgcgcacacatctccactgcgac
gtcaactttggggctctgctgtcggggggcgtggactccagcctgattgccgcgatcgcc
acgaagatcatgcgggagaaagacccttactatcgcctgaagaccttctctgtgggtctg
gccgatgcgcccgattttaaggcggcccgccacgtggccaagtacatcggcagtgaccac
aaggagatcgtctttcaaattgatgaggccctagacgggatccgcgatattgtctatcac
ctggagacctatgacgtcaccactgtgcgctgcagcctgccaatgctgctgctgacccgc
tacatcaagagtaccggcatcaagatgatcctctccggcgagggggcggacgagatcttc
ggcggatacctgtacttccacaaggcccccaactgcgagcagttccaccaggagctggta
aagcgcgtacagcagctacatctctccgactgcctgcgcgccaacaaggtggcgatggcc
aagggcgtggagctgcgcgtacccttcctggacacgggcttcgtcaatcatgtgatgcag
atccggccccaggacaagattcctggcgagctcaacgcgtttgccgaagccctaggaccc
ttgaggcgcattgagaagtacgtgttgcgggctgccttcaccgaaaactatttgccggac
gacgtgctttggcgccagaaggagcagttttccgacggcgtcggctacgactggattgat
agcatccgccgtgtggccaccagtcacgtgggagacgaggagttcgccgaggctacccgc
agattccccttcaacacgcccaccacaaaagaggcattctactatcgaagcatcttcgag
gagcagttcccggtcgagggagcggcccgcacggtggtcaggtgggtgccacgcctggat
tggggctgtccggaggacccctcgggacgggcacaggccgtccatcaagtcaataaagac
gctataatttaa

DBGET integrated database retrieval system