KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_12105Help
Entry
DICPUDRAFT_12105  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 131 aa AA seqDB search
ENKEKAVTPKVTKTAADGEKKKTKRKKSDYTSFSTYIHKLLKQITPSTGKSENKKFTISS
KAMAVMNSFVHDIFERIANEAGGLAKKKKRHTLHSRDIQVAVRIILTGELAKHAILQGMT
AVNKYHPQSSE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gaaaacaaagaaaaagctgtaactccaaaagttaccaagaccgccgctgatggtgaaaag
aaaaaaaccaaaagaaagaagtctgattacacctctttctcaacttatatccacaagtta
ttaaaacaaattaccccatccaccggtaaatctgaaaacaagaaattcaccatctcctca
aaagccatggccgttatgaactcattcgtccacgatatcttcgaacgtatcgccaatgaa
gctggtggtttagccaaaaagaaaaagagacacactctccactctcgtgatatccaagtt
gctgttcgtatcattttaactggtgaacttgccaaacacgctattcttcaaggtatgact
gctgtcaacaaataccatccacaatcatcagaa

DBGET integrated database retrieval system