KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_146855Help
Entry
DICPUDRAFT_146855 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DICPUDRAFT_146855
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   DICPUDRAFT_146855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 249 aa AA seqDB search
MSEQQLIETQKNWIPLEANPDVLTSFMQNLGVSKDWEFCDIYGTEDELLDMVPKPCAAVL
LLFPITNAYEEKRRILQEEINKNGQILSDNVYFMKQYIGNACGTIGVIHSVLNNSDVIEF
NEDGFFKQFLEKTGSLTTEERAISLMQNSEIEKSHEISAQQGQSSVPSEDEIIVLHFVSF
VHVDGHLYELDGRKPFAVNHGPSTQETLLKDVATVLNKMIEENPEEIRFNLMGLVKKQQE
EEEEKKEEN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaacaattaattgaaactcaaaagaactggatcccactcgaagccaaccca
gatgttttaacttcatttatgcaaaatttaggtgtttctaaagattgggaattctgtgat
atatatggtaccgaagatgaattattagatatggtaccaaaaccatgtgctgctgtattg
ttattattcccaattacaaatgcttatgaagaaaaaagaagaatattacaagaagaaatt
aataaaaatggtcaaattttatcagataatgtttattttatgaaacaatatattggtaat
gcatgtggaacaattggtgttattcattcagttttaaacaattcagatgttatagaattc
aatgaagatggtttctttaaacaatttttagaaaaaactggctccctaactaccgaagaa
agagccatttcattaatgcaaaattcagaaatcgaaaaatcacacgaaatcagtgctcaa
caaggtcaatcatctgtaccaagtgaagatgaaataatcgttttacattttgtctcattt
gttcatgtcgatggtcacttatatgaattagatggtagaaaaccatttgcagttaatcac
ggtccatcaacacaagaaacactattaaaagatgttgcaactgtcttaaataaaatgatt
gaagaaaatccagaggaaattagatttaatttaatgggtttagttaaaaaacaacaagag
gaagaggaagaaaaaaaagaagaaaactaa

DBGET integrated database retrieval system