KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148003Help
Entry
DICPUDRAFT_148003 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00500  Starch and sucrose metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_148003
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     DICPUDRAFT_148003
Glycosyltransferases [BR:dpp01003]
 Polysaccharide
  Storage polysaccharide
   DICPUDRAFT_148003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_transf_5 Glyco_trans_1_4 Glyco_trans_4_4 DUF2046
Motif
Other DBs
NCBI-GeneID: 10510170
NCBI-ProteinID: XP_003284266
JGI: Dicpu1_148003
UniProt: F0ZA00
Position
Unknown
AA seq 853 aa AA seqDB search
MIFGTPNSTFLESKLHSSQGMTFSSMASGSGSGGLLHSSSGSSITEEVSLPPSNTVLFDI
SWEVAKKVGGIYTVLKSKAPVTVEEYKSRYALIGPYNSETAPTEFEPLVPGPLSSPIIEN
MMKKYGIQVHFGKWLVEGYPKVFLIDLPSSSHKLGEWRWDLMSGFEQPGDHETNESIVFG
YQSALLLKEFAEANPNDKYIAHFHEWQASVGLILLKKWKIPVSTIFTTHATLLGRYLAAG
GVDLYNQIQNLNIDYEASKRGIYHRHWIEKKSANDAHVFTTVSEITAYESESILSRKADV
ILPNGLKLDKFTALHEFQNLHAKYKNVLHEFVRGHFYGHYDFDLDNTLYVFTAGRSEYFN
KGVDMFLDALAGLNKLLQQSGSTMTIVAFIIMPSKTNNFNIDTLKGQSHNRDLRRTCNSI
VESMGERLFEATSRGRIISPEELLTQEDLVFLKRRIFALKQRPSLPPIVTHNMMDDVNDP
ILNHLRKIKLFNSKEDRVKIIYHPEFLNSTNPLIPLDYTEFVRGCHLGIFVSYYEPWGYT
PAECTVLGVPSITSNLTGFANYMSRGLNEPESKGIFIVDRRFKSPNESVEQVTQYLWKFC
QMDRRQRIELRNRTEKLSELLDWKTLGKFYRSARSLAIERAFPPSKPISRSPSPSPTSNT
LKNSTSIQQLQQQLKQQVEQQQKEQQQQQQQQQTIPINIGKGETSQLSPNTMSSLLSDSL
NISNKKSSSLSGGAKFAESTINPTPNNTPSIITTSVGSSSKPPLPTTTTATVSNTPTNTP
TIATVSSASVNTTKNSFQPSSQKSSSVNPIEQLTKLNSPTDRDFKNPLNESGDGTSPSKA
KSKSIPIPSNKFK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgatatttggaacaccaaattctacatttctagagagtaaactacatagtagtcaaggt
atgacattcagcagtatggcaagtggcagtggtagtggtggtttattgcatagttcgtca
ggttcaagtatcaccgaggaagttagtttaccaccaagcaataccgtattgtttgatatt
tcttgggaagttgctaaaaaagttggtggtatttatacagtattaaaatcaaaagcacct
gttactgtcgaggaatataaatcaagatatgcattaattggaccatataattcagagact
gctccaacagagtttgaaccattagtacctggtcctctttcatcaccaatcattgaaaac
atgatgaaaaagtatggtattcaagttcattttggaaagtggttagtagagggttatcca
aaagtatttttaattgatttaccaagttcatcacataagttaggagagtggagatgggat
ttaatgagtggttttgaacaacctggggatcatgaaaccaatgaaagtatagtgtttggt
tatcaatcagctctattgttaaaagaatttgcagaggctaatccaaatgataaatatatt
gctcatttccacgagtggcaagcatcagttggtttaatattattaaaaaaatggaaaata
cctgtatcaacaatttttacaactcatgcaacattactaggcagatatttagcagcaggc
ggtgtagatctttacaatcaaatccaaaacttaaatattgattatgaagcatcaaaaaga
ggaatttatcatagacattggatcgaaaagaaatctgcaaatgatgcccatgttttcaca
actgtatcagaaattacagcatacgagtctgaatctattctttcaagaaaagctgatgtt
atcttaccaaatggtttaaagttagataaattcactgcattacacgaattccaaaactta
catgcaaaatataaaaatgttttacatgaatttgtaagaggtcatttttatggtcattat
gactttgatttagataatacattatatgtttttacagctggtagatcagaatattttaat
aaaggtgtggatatgtttttagatgcattggctggattaaataaacttttacaacaaagt
gggtcgacaatgacaattgtagcttttattattatgccatcaaaaacaaataacttcaat
atcgatacattaaagggtcaatcacataatagagatctcagaagaacctgtaattcaatt
gtagaatcaatgggagaaagattatttgaagctacttcaagaggtagaattatttcacca
gaagagttattaacccaagaggatttggtattcttaaaaagaagaatttttgcattaaaa
caaagaccatccttaccaccaattgtaacacataatatgatggatgatgttaatgatcca
attttaaaccatttaagaaaaatcaagctattcaattccaaagaagatcgtgtaaaaatt
atttatcatccagagttcttaaactctaccaatccattaataccactagactataccgag
tttgttagaggttgccatttgggtatttttgtaagctactacgagccatggggctataca
ccagccgaatgtactgtattgggtgtaccatcaatcacaagtaatttaactggctttgca
aattatatgagcagaggtcttaatgaaccagagtcaaaaggtatttttattgtagatcgt
cgtttcaaatcaccaaatgaatctgttgaacaagttacccaatatctatggaaattctgc
caaatggatagaagacaaagaattgaacttagaaatcgtactgaaaaactatctgaactt
ttagattggaaaactttaggtaaattttatagatctgctcgttcattagcaatcgaaaga
gcttttcctccttcaaaaccaatttcaagatcaccttcaccttcaccaacttcgaatact
ttaaaaaactctaccagcattcaacaattacagcaacaattaaaacaacaagtagagcaa
caacaaaaagaacagcaacaacaacaacaacaacaacaaactatcccaattaatataggt
aaaggtgaaacatctcaactttcaccaaacacaatgtcttcactattaagcgattcttta
aatatttcaaacaaaaagtcttcatcactaagtggtggtgctaaatttgctgaatcaaca
ataaacccaacaccaaataatacaccttcgataattacaacctcggtcggttcatcctct
aaaccaccactcccaacaacaacaacagcgacagtatcaaatactccaacaaatacccca
acaatagctactgtttcatctgcttccgttaacacaactaaaaattcatttcaaccatct
tcacaaaaatcatcatctgtaaacccaattgaacaattaacaaaactaaattctccaacc
gatagggattttaaaaatcctcttaatgaaagtggtgatggaactagtccatcaaaagca
aaatctaaatcaataccaatcccatcaaataaatttaaataa

DBGET integrated database retrieval system