KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148003Help
Entry
DICPUDRAFT_148003 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_148003
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     DICPUDRAFT_148003
Glycosyltransferases [BR:dpp01003]
 Polysaccharide
  Storage polysaccharide
   DICPUDRAFT_148003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 853 aa AA seqDB search
MIFGTPNSTFLESKLHSSQGMTFSSMASGSGSGGLLHSSSGSSITEEVSLPPSNTVLFDI
SWEVAKKVGGIYTVLKSKAPVTVEEYKSRYALIGPYNSETAPTEFEPLVPGPLSSPIIEN
MMKKYGIQVHFGKWLVEGYPKVFLIDLPSSSHKLGEWRWDLMSGFEQPGDHETNESIVFG
YQSALLLKEFAEANPNDKYIAHFHEWQASVGLILLKKWKIPVSTIFTTHATLLGRYLAAG
GVDLYNQIQNLNIDYEASKRGIYHRHWIEKKSANDAHVFTTVSEITAYESESILSRKADV
ILPNGLKLDKFTALHEFQNLHAKYKNVLHEFVRGHFYGHYDFDLDNTLYVFTAGRSEYFN
KGVDMFLDALAGLNKLLQQSGSTMTIVAFIIMPSKTNNFNIDTLKGQSHNRDLRRTCNSI
VESMGERLFEATSRGRIISPEELLTQEDLVFLKRRIFALKQRPSLPPIVTHNMMDDVNDP
ILNHLRKIKLFNSKEDRVKIIYHPEFLNSTNPLIPLDYTEFVRGCHLGIFVSYYEPWGYT
PAECTVLGVPSITSNLTGFANYMSRGLNEPESKGIFIVDRRFKSPNESVEQVTQYLWKFC
QMDRRQRIELRNRTEKLSELLDWKTLGKFYRSARSLAIERAFPPSKPISRSPSPSPTSNT
LKNSTSIQQLQQQLKQQVEQQQKEQQQQQQQQQTIPINIGKGETSQLSPNTMSSLLSDSL
NISNKKSSSLSGGAKFAESTINPTPNNTPSIITTSVGSSSKPPLPTTTTATVSNTPTNTP
TIATVSSASVNTTKNSFQPSSQKSSSVNPIEQLTKLNSPTDRDFKNPLNESGDGTSPSKA
KSKSIPIPSNKFK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgatatttggaacaccaaattctacatttctagagagtaaactacatagtagtcaaggt
atgacattcagcagtatggcaagtggcagtggtagtggtggtttattgcatagttcgtca
ggttcaagtatcaccgaggaagttagtttaccaccaagcaataccgtattgtttgatatt
tcttgggaagttgctaaaaaagttggtggtatttatacagtattaaaatcaaaagcacct
gttactgtcgaggaatataaatcaagatatgcattaattggaccatataattcagagact
gctccaacagagtttgaaccattagtacctggtcctctttcatcaccaatcattgaaaac
atgatgaaaaagtatggtattcaagttcattttggaaagtggttagtagagggttatcca
aaagtatttttaattgatttaccaagttcatcacataagttaggagagtggagatgggat
ttaatgagtggttttgaacaacctggggatcatgaaaccaatgaaagtatagtgtttggt
tatcaatcagctctattgttaaaagaatttgcagaggctaatccaaatgataaatatatt
gctcatttccacgagtggcaagcatcagttggtttaatattattaaaaaaatggaaaata
cctgtatcaacaatttttacaactcatgcaacattactaggcagatatttagcagcaggc
ggtgtagatctttacaatcaaatccaaaacttaaatattgattatgaagcatcaaaaaga
ggaatttatcatagacattggatcgaaaagaaatctgcaaatgatgcccatgttttcaca
actgtatcagaaattacagcatacgagtctgaatctattctttcaagaaaagctgatgtt
atcttaccaaatggtttaaagttagataaattcactgcattacacgaattccaaaactta
catgcaaaatataaaaatgttttacatgaatttgtaagaggtcatttttatggtcattat
gactttgatttagataatacattatatgtttttacagctggtagatcagaatattttaat
aaaggtgtggatatgtttttagatgcattggctggattaaataaacttttacaacaaagt
gggtcgacaatgacaattgtagcttttattattatgccatcaaaaacaaataacttcaat
atcgatacattaaagggtcaatcacataatagagatctcagaagaacctgtaattcaatt
gtagaatcaatgggagaaagattatttgaagctacttcaagaggtagaattatttcacca
gaagagttattaacccaagaggatttggtattcttaaaaagaagaatttttgcattaaaa
caaagaccatccttaccaccaattgtaacacataatatgatggatgatgttaatgatcca
attttaaaccatttaagaaaaatcaagctattcaattccaaagaagatcgtgtaaaaatt
atttatcatccagagttcttaaactctaccaatccattaataccactagactataccgag
tttgttagaggttgccatttgggtatttttgtaagctactacgagccatggggctataca
ccagccgaatgtactgtattgggtgtaccatcaatcacaagtaatttaactggctttgca
aattatatgagcagaggtcttaatgaaccagagtcaaaaggtatttttattgtagatcgt
cgtttcaaatcaccaaatgaatctgttgaacaagttacccaatatctatggaaattctgc
caaatggatagaagacaaagaattgaacttagaaatcgtactgaaaaactatctgaactt
ttagattggaaaactttaggtaaattttatagatctgctcgttcattagcaatcgaaaga
gcttttcctccttcaaaaccaatttcaagatcaccttcaccttcaccaacttcgaatact
ttaaaaaactctaccagcattcaacaattacagcaacaattaaaacaacaagtagagcaa
caacaaaaagaacagcaacaacaacaacaacaacaacaaactatcccaattaatataggt
aaaggtgaaacatctcaactttcaccaaacacaatgtcttcactattaagcgattcttta
aatatttcaaacaaaaagtcttcatcactaagtggtggtgctaaatttgctgaatcaaca
ataaacccaacaccaaataatacaccttcgataattacaacctcggtcggttcatcctct
aaaccaccactcccaacaacaacaacagcgacagtatcaaatactccaacaaatacccca
acaatagctactgtttcatctgcttccgttaacacaactaaaaattcatttcaaccatct
tcacaaaaatcatcatctgtaaacccaattgaacaattaacaaaactaaattctccaacc
gatagggattttaaaaatcctcttaatgaaagtggtgatggaactagtccatcaaaagca
aaatctaaatcaataccaatcccatcaaataaatttaaataa

DBGET integrated database retrieval system