KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148280Help
Entry
DICPUDRAFT_148280 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 708 aa AA seqDB search
MEMVLEYVDLIESLIIDNLGAIIIVVVIVGTYLYMNKPPPPPPIPQNKKAPIKPQRTESN
KGGKKENKEKEKVMKIFFGTQTRTAEDFSRIIEKESKKIGIPCEVVDLESYDVEDLANEW
FVMFLVSTHGEGDPTDNAKEFYLWLTNDERPTDLLTGVPFTVFGLGNKTYEHYNAVARVI
DRRMEELGAKRAFERGEGDDDATLEEDFNHWKKRMWPVICPFLGYELKATDEDKFVPRFR
MVTLDSENKDITNPFLKVVPTISKPKTSVDGKTIYDIKNPYYATITENRELHSSESDRSC
RHIEFALGGAVTYQTGDHLGIYPINDGELVEKLIQRLGVNGEEIISLIPADQEGNIIKAS
FGPMSIRKALSEHFDITNPPRKSVLRTLSEYTTDEQEKKKLLRLASEEASEEYNQFIKHD
FRSIGELLDNFPNLKPNIAHFLEFIPRLPARYYSISSSPNHKKDTVSITSVVVNFTTPTS
RFHNGVASTWLSNLKVGDKVPLFVRESHFRLPSNTNKPVIMVGPGTGLAPFRGFLQEMQH
KSVNSSESLLFFGCRSDTIDYLYKEELEQYKSTGVIGDLIVAFSRKTNEKVYVQNKIMEH
KHKVWDLIHNKGAHFYICGDARNMAKSVQQSLVSLIKELGSKDDNSAQQYIEDMESVKKI
INISSIVGFYSRQCGFSIYSSTKFAVEAITEGLQEDVIHVSSILPGYF
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggttttagaatatgttgatttaatcgaatcattaattatcgataatttgggc
gcaattattattgttgttgttattgttggtacatatttatatatgaataaacctccacca
ccaccaccaattccacaaaacaaaaaagcaccaatcaaaccacaaagaacagaatcgaat
aaaggtggcaagaaggaaaataaagagaaagaaaaggtaatgaaaatcttttttggtaca
caaactagaactgcagaagatttttcacgtattatcgaaaaggaaagtaaaaagattggt
atcccatgtgaagttgttgatttagaatcatatgatgtagaagatttagctaatgaatgg
tttgttatgttcctcgtttcaactcatggtgaaggtgatccaacagataatgccaaagag
ttttatttatggttaactaatgatgaacgtccaaccgatcttttaactggtgtaccattc
actgtttttggtttaggtaataaaacatatgagcattataatgccgttgcaagagttatc
gatagaagaatggaagaactaggcgctaaaagagcttttgaaagaggtgaaggtgatgat
gatgctactctcgaagaagatttcaatcactggaaaaagagaatgtggccagttatttgt
ccattccttggttatgaattaaaagccacagatgaagataaatttgtaccacgtttcaga
atggtcactttagattctgaaaataaagatatcactaatccattccttaaagtagttcca
actatttcaaaaccaaaaacttcagttgatggaaaaactatttatgatattaaaaatcca
tattatgcaactattacagaaaatagagaattacattcaagtgaatcagatagatcatgt
agacatattgaatttgcattaggaggtgcagttacttatcaaactggtgatcatttagga
atttacccaattaatgatggtgaattagtcgaaaaacttattcaacgtttaggtgttaat
ggtgaagaaataatttcattaattccagcagatcaagaaggtaatattattaaagcatca
tttggcccaatgtcaattagaaaggctttatcagaacatttcgatattacaaatccacca
agaaaatcagttttacgtaccctctctgaatacaccaccgacgaacaagaaaagaagaaa
ttattacgtttagcctcagaagaagcatcagaagaatataatcaattcattaaacatgac
ttccgtagtattggtgaattattggacaatttcccaaatcttaaaccaaatattgcacac
tttttagaattcatccctcgtttaccagctcgttattactctatctcttcatcaccaaat
cacaagaaagatacagtttctattacttcagttgttgttaatttcactacaccaactagt
cgtttccataatggtgtcgcctctacttggttatcaaacttaaaagttggcgataaagtt
ccattattcgttagagaaagtcatttccgtttaccatccaatactaataaaccagtcatt
atggttggtccaggtaccggtttagcaccatttagaggtttccttcaagagatgcaacac
aagagtgttaattcttccgaatctcttttattctttggttgccgttctgatactatcgat
tatctctacaaagaagaattggaacaatacaagagtactggtgttattggcgatctcatt
gtagctttttcaagaaaaacaaacgaaaaagtttacgttcaaaataaaatcatggaacat
aaacataaagtttgggatctcattcataataagggcgctcacttttatatttgtggtgat
gctagaaatatggccaaatcagttcaacaatctttagtttctttaattaaagaattaggt
tcaaaagatgacaactctgctcaacaatatattgaggatatggaatctgtaaaaaaaatt
ataaatatatcctcaattgttggattttatagtagacaatgtggattttcaatttattca
tccacaaaatttgcagtagaggctattactgaaggtttacaagaggatgttattcatgtt
tcttctattttaccaggttatttttaa

DBGET integrated database retrieval system