KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148310Help
Entry
DICPUDRAFT_148310 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_148310
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DICPUDRAFT_148310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 560 aa AA seqDB search
MFKNIFLISIAFCLLINTAISQQCFNKNNLNWRSGNNKLSLNDQQITIQGIAWFGMETGT
FSPGGLKTTSVEALLDLLVQLKFNALRLPFSVDMILNNRYPNEINYSLNPNLRGKTALQV
LQYITEKSGERGILVVLEQHRFDPSDYISALWYSTQCITNVDGACVNYTPELVVQSWITL
TKLFQQYWNLWALDIKNEPHDPATWGAGNPATDFDKAFTSISNQIGSATNFNGVYFIEGV
QNNNAICSNNYNNWWGGNMSPVQCFPVYLNQADRLVYAPHTYCSSVFDQEYFNTADYPEN
MPTVWDSQFGFLYNNYYALVLGEWGCKLNNTKNQKWMDRFVTYLNDKNIKSHLFFSLNPD
SADTDSPLYADWKSINQNTVNVLNRINSSPTKFTPNGNQICLGAVSTTTAPATTGVASTT
GKPSTTGSATTGSATTGSATTGSATTGSATTGSATTGSVTTTGSTSGSSNIIINQVVRQT
WFDGTSNYMVVDGTIKNGGSTNTNSPKLRSDKIPQQIWGLDSGAGNTWTLSWNPTLTPGQ
SIEFGYIVASSSPIQFTIIA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaatatatttttaatatcaatagcattttgcttattgataaatacagccatt
tcccaacaatgcttcaacaaaaataatttaaattggagatcgggaaacaacaaattgtca
ttaaacgatcaacaaatcacaattcagggtatagcttggttcggtatggaaactggtact
ttttcaccaggtggtttaaaaactacatcagtcgaagctttattggatttattggtccaa
ttaaaattcaatgctcttcgtctcccattctctgtcgatatgattttaaacaatcgttat
ccaaatgaaatcaattacagcctcaatccaaatcttcgtggtaaaacagctcttcaagtt
cttcaatacattaccgaaaaatctggtgaacgtggtattttagtagttttagaacaacac
agattcgatccatcagattacatctctgctctttggtattccactcaatgtattacaaat
gtagatggtgcttgtgtaaactatactccagaattagtagtccaatcatggatcacatta
acaaaattattccaacaatattggaatttatgggctttggatattaagaatgaaccacat
gacccagctacatggggagccggaaatccagcaactgattttgataaagcattcacatcc
atttcaaaccaaattggttccgccacaaacttcaacggtgtttatttcattgagggtgtc
caaaataataatgctatttgctctaataattacaacaattggtggggaggtaatatgtca
ccagtccaatgtttcccagtttatttgaaccaagccgaccgtcttgtttatgccccacac
acttattgctcaagtgtcttcgatcaagaatactttaatactgccgattacccagaaaat
atgccaactgtttgggatagtcaatttggtttcctctacaacaactactatgctctcgtt
ttaggtgaatggggttgcaaattaaacaacactaaaaatcaaaaatggatggacagattt
gttacctatttaaatgacaaaaatatcaagagccatcttttcttctctttaaacccagac
tctgccgataccgactcaccactctatgctgattggaaatcaattaaccaaaatacagtc
aatgttttaaatagaattaattcaagtccaactaaatttacaccaaatggaaatcaaatt
tgtttaggcgctgtttcaactaccactgctccagcaacaactggtgttgccagtacaact
ggaaaaccctctacaactggtagtgcaacaactggctccgcaacaactggtagtgcaaca
actggtagcgcaacaactggctctgcaacaactggtagtgcaacaactggtagtgtaaca
actacaggatcaacaagtggttcatcaaatatcattattaaccaagtagtaagacaaaca
tggtttgatggtacaagcaactatatggtagttgatggtacaattaaaaatggtggatca
acaaatactaatagtccaaaacttcgttcagataagattccacaacaaatttggggttta
gatagtggtgctggtaatacatggactctttcatggaatccaactttaactccaggccaa
tcaatcgaatttggttatattgttgcatcaagttctccaatccaatttacaattattgct
taa

DBGET integrated database retrieval system