KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148338Help
Entry
DICPUDRAFT_148338 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1449 aa AA seqDB search
MDKYNFSNTNLANSNSLQNSINSNNVNGVSSNSMNSNNNNNNNNNNSNNNNGNNNNNNSS
NNNDGNKNNERHQNKKKEKFNNKSKAFFTEERHRDNATPDLQKTKIAKWRMRERMKTVSV
ALVLCLNIGVDPPDVIKTYPCARMECWIDPASQPPQKSLDLIGKTLQAQYEKWQSKARYK
QCLDPTVEEVKKLCLSLRRNAKEERVLFHYNGHGVPKPTTNGEIWVFNRNFTQYIPLSIY
ELQTWMGTPSIYVFDCSAAGLIINWFNQFAEQRDKELERFNNNSQQPQSQSQQQGGSNTP
QNVNSNNNSSNNSNTNSPNMSSNSANNAQSAQSHQRDCILLAACSANEILPMNPDFPADM
FTACLTTPIRIALRWFCSHSILTGITPDMLDRIPGNLSSRRTPLGELNWIFTAVTDTIAW
NVLPRHLFQKLFRQDLLVASLFRNYLLAERIMRSANCTPISCPRLPPTYQHPMWQAWDLA
ADLVISQLPTLLADPNAEFKSSPFFSEQLTAFEVWLEFGSEQKEPPAQLPIVLQVLLSQA
HRLRALVLLGKFLDLGPWAVNLALCVGIFPYVLKLLQSPAGDLRHILVFIWAKILALDKS
CQLDLVKENGHAYFISVLSSPSIPADQRTMSAFVLSTICNNCRPGQNACLIGNLLPICLS
QLSDPDPMVRRWMILCMAKMWENFEEAKWAAIKECAHEKLCLLLTDVCPEVRASAVVALG
ELIGGAEGSEQRTNIELNLALTLAVITADCSPMVRKELVIALSRIVSSYEGNFISVAQEI
AHEERQRAIFEAKRLEELRKSKKRPISKGPDTDLSNSDLYSNGPQSSVYGCIWKIILNLC
TDPFDQVANRAQSIVKRISSKFALEELVSHNLINRTNFNGNVNQYYLNNSSGGIGGVGLN
NSNGGNFNVNSLNNSNGGGGGGLNSSTSSIRNTIVNISRITNRDPRSPAKTKLGAQRSPI
LTSSNSQVNNSGNMVNNLNNSNSSNGFYSNNSNLNSSANIGGVGNLSNTFSSISLSGSLG
GNSRSRMSSSTPGNQSLPNDFLISDMMPFEEDELYSDYYEWSCNYFSKPMMQSIGEDSES
FESVEKKWKRIRNEGIIQESKESVQTIINNPPKTFSQMSIFAENNGQPISHLQFHPFENV
LIVSDGLENISIWNYDEGQRINAFNNCNMPGTKITTMRLVNDYESSMIITAADDGVVRLW
RGYESNETLKMVSSWRAFPEFATTGNEPIGRLVLDWKGDSGLVMVSGETPDCPKIRIWDI
ERELGIQDILIGTESVVTCMTNEKRGPLFAAGFSDGLVKLFDQRVQSKYSCVSTLTEHKS
YIVNISMPGSLGGKTVVSSSSTGEIKFWQHTYECSSNTILNNDVISSFTVHDNAPLIATG
SQNQRIKIMNFTGEEVCTIRYHDGFLGQRIGPVSCLAFHPYNILMGAGATDSIVSIYNGD
SNKNKTVDW
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atggataaatataattttagtaatacgaatttagccaattcaaatagtcttcaaaatagt
ataaatagtaataatgtaaatggagtttcctcaaatagtatgaatagtaataataataat
aataataataataacaatagtaacaacaataatgggaacaacaataacaataacagcagc
aacaataatgatggcaataaaaataacgaaagacatcaaaataaaaagaaagaaaaattt
aacaataaatctaaagcattctttacagaagaaagacatagagataatgcaacaccggat
ttacaaaagaccaaaattgctaaatggagaatgagagaaaggatgaaaacagtttcagtt
gcattggtattatgtttaaatattggcgtagatccaccagatgttattaaaacatatcca
tgtgcaagaatggaatgttggatagatcctgcatcacaaccaccacaaaaatcattagat
ttaattggtaaaacattacaagcccagtacgaaaaatggcaatcaaaagcaagatacaaa
caatgtttagatccaacagtagaggaagttaaaaaactttgtctttcattaagaagaaat
gcaaaagaagaaagagtattgtttcactataatggtcacggtgtaccaaagccaactacc
aacggtgaaatctgggtatttaatagaaattttacacagtatatcccattgtctatttat
gaacttcaaacatggatgggtaccccaagtatttatgtatttgattgttcagctgcaggt
ttaattataaattggttcaatcaatttgcagaacagcgtgataaagaattggagcgtttt
aataataatagtcaacaaccacaatcccaatcacaacagcagggtggttcaaatacacct
caaaatgtaaactctaataataattcaagtaataatagtaatacaaatagcccaaatatg
agcagcaacagtgcaaataatgctcaatcagctcaatctcatcagcgtgattgtattctt
ttagcagcatgtagcgcaaatgaaattttaccaatgaatccagattttccagccgatatg
tttacagcatgcttaactactcctattcgaatcgcattaagatggttttgcagccactca
attcttactggtattactccagatatgttagaccgtattccaggcaatcttagtagtaga
cgtacacccttgggtgagttaaattggatttttactgcagttaccgataccattgcatgg
aatgtgctcccaagacatttgttccaaaaacttttccgtcaagatcttttggtagcttct
ctctttagaaattatttgcttgctgagcgtattatgagatctgcaaattgtacacctatc
tcatgtccaagattacctccaacatatcaacatccaatgtggcaagcttgggatttagca
gcagatcttgtaatttctcaattgccaacacttttagcagatccaaatgctgaatttaaa
tcaagtccattctttagtgaacaattaactgcttttgaagtttggttagaatttggatca
gaacaaaaagaaccacctgctcaattaccaattgtattacaggttttacttagccaagct
catcgtttaagagctttggtactcttaggtaaattccttgaccttggtccatgggctgta
aatttggctttgtgtgttggaatcttcccatatgtattaaaattacttcaatcaccagct
ggcgatcttcgtcacatcctcgttttcatttgggctaaaatattggcactcgataaatca
tgtcaattagatttggttaaagaaaatggtcatgcttattttattagtgtattaagttca
ccatcaatcccagccgatcaaagaacaatgtctgcatttgtactttcaaccatttgcaat
aattgtagacctggtcaaaatgcatgtcttattggaaatcttttaccaatttgtttatca
caacttagtgacccagatcctatggttcgtcgttggatgattctttgtatggccaaaatg
tgggaaaatttcgaagaggccaaatgggcagcaattaaagaatgtgcacatgagaagctt
tgtcttcttttaactgatgtttgcccagaggttagagcaagtgctgttgttgcattgggt
gagttaataggtggagcagaaggaagcgaacaaagaactaatatcgagttaaatcttgca
cttactcttgctgttattactgctgattgttccccaatggttaggaaagagttggtaatt
gctctctctagaatcgtttcatcatatgaaggtaattttatttcagtagcacaagaaatt
gcacatgaagaaagacaaagagctatttttgaagccaaacgtttagaagaattaagaaaa
tcaaagaaaagaccaatatcaaaaggtccagataccgatctttcaaatagtgatctctat
agtaatggtccacaatcaagtgtttatggttgcatttggaagattatattaaatctttgt
acagacccatttgatcaagttgctaatcgtgcccaatcgatcgtaaagagaatttcatct
aaatttgcattagaagaactcgtttcacataatttaatcaatcgtacaaatttcaatgga
aacgtaaatcaatattatcttaataatagcagtggtggtattggtggcgttgggttaaat
aatagtaatggtggcaactttaatgtaaactctttaaataatagtaatggtggtggcggt
ggtggtttaaatagcagcaccagctcaattagaaatacaattgtaaatatttctcgtatt
acaaatagagacccaagatcaccagctaaaacaaaactcggtgctcaaagatcaccaatt
ttaacttcatcaaacagccaagtcaacaatagtggtaatatggttaataatttaaataat
agtaatagtagtaatggtttttatagtaataattcaaatttaaattcatcagctaatatt
ggcggtgttggtaatttatcaaatactttttcatcaatctcattaagtggttcattgggt
ggtaatagtagatcaagaatgtcctcatccactccaggtaatcaatctttaccaaatgac
tttttaatatccgatatgatgccatttgaagaagatgaactttattcagattactatgaa
tggagctgtaattatttctctaaaccaatgatgcaatcaattggtgaagactccgaatca
tttgaatctgtagagaagaaatggaagcgtataagaaacgaaggtattattcaagaatct
aaagaatcagtacaaaccattattaataatccacccaaaactttttcacaaatgtcaatt
tttgcagaaaacaatggtcaaccaatttcccaccttcaattccatccattcgaaaatgtt
ttaattgtatcagatggtcttgaaaatattagtatttggaactatgatgaaggtcaacgt
ataaacgcttttaacaattgtaatatgccaggtaccaaaattactacaatgagattagta
aacgattacgaatcatcaatgattataacagcagccgacgatggtgtagttagactttgg
aggggttatgaaagtaatgaaacactcaaaatggtttcaagttggagagcattcccagaa
tttgcaaccactggtaatgaaccaattggccgtctggttttggattggaaaggtgacagt
ggtttggtaatggtatcaggtgaaacacctgattgtcctaaaattagaatttgggatatc
gaaagagaattgggtattcaagatatattaattggcacagaaagtgttgtaacttgtatg
accaatgaaaaaagaggtccattatttgctgcaggtttctctgatggtttggttaaatta
ttcgatcaaagagttcaaagtaaatatagctgtgtctctactttaaccgaacataaatca
tatattgtcaatatttcaatgccaggaagtcttggtggtaaaactgttgtatctagtagt
agtacaggggaaattaaattctggcaacatacttatgaatgttcatcaaatactatactc
aataatgatgtcatttcttcatttacagtccacgataatgctccattaattgccactggt
tctcaaaatcaaagaattaaaattatgaattttactggtgaagaagtttgtacaattaga
tatcatgatggtttcttaggtcaaagaattggtccagtatcttgtttagcattccatcca
tataatattttaatgggtgctggtgcaaccgattcaattgttagtatttataatggtgat
tcaaataaaaataaaactgtagattggtaa

DBGET integrated database retrieval system