KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148649Help
Entry
DICPUDRAFT_148649 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 342 aa AA seqDB search
MLFNSSVTNNHNPNKDIELQGPINDGISCLKFSPKTSNLIVAGSWDQKIRCWEVNTPSLS
SQPRAMISHEAAILCTDWNGDGTQVFTGGVDNKVKLWNLQTNQMVQVAQHNAPVKDCFWI
EESKVLVTGGWDKSIKYWDTRQSTPVLSLDLSERVYAMDCLYPLLVVATADRKIYVYNLQ
NPSVPYKTMESLLKYQTRSIACFGEKNGFALGSIEGRVAIQSFEEKPELSFTFKCHREND
TLAYAVNSISFALPYGTFATAGSDGGFSFWDKESKFRLKQFTKVPQPITCTAFNSDASLY
AYASSYDWSKGSQGFDPNSQSYVFVHPVGDEAKKGNRTAKKR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaatagttcagtcacaaataaccataatccaaataaagatatagaattacaa
ggaccaattaatgatggtatatcttgtttaaagttttcacccaaaacaagtaatttaatt
gtagcaggttcatgggatcaaaagattagatgctgggaagttaacacaccatcattatca
tcacaaccaagagcaatgatcagccacgaagcagcaattttatgtactgactggaatggt
gatggcacacaagtatttacaggtggtgttgataataaagttaaactttggaatttacaa
actaatcaaatggttcaagtcgcacaacataatgcaccagttaaagattgtttttggatt
gaggaaagtaaagttttggttacaggtggttgggacaaatcaattaaatattgggatacc
agacagtcaacccctgttctttcattggatctctcagaaagagtttatgctatggattgc
ctttatccattattagtagttgcaacagcagatcgtaaaatctacgtatacaatctccaa
aacccaagtgttccatataaaacaatggagtcattattaaaatatcaaactcgtagtatt
gcatgttttggtgaaaagaatggttttgctttaggctctattgagggtcgtgttgcaatt
caatcatttgaggaaaagccagaattatcatttacattcaagtgtcatagagaaaatgat
acattagcatacgcagttaactcaatttcatttgcattaccatatggtacttttgcaaca
gcaggttcagatggtggtttcagtttttgggataaagaatctaaatttagacttaaacaa
tttaccaaagtaccacaaccaattacatgcacagctttcaattccgatgcaagcttatat
gcttatgcatcatcatacgattggtctaaaggtagtcaaggttttgatccaaatagtcaa
agttatgttttcgttcacccagttggtgatgaagctaaaaaaggtaatagaacagcaaaa
aaaagataa

DBGET integrated database retrieval system