KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148649Help
Entry
DICPUDRAFT_148649 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DICPUDRAFT_148649
Messenger RNA biogenesis [BR:dpp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     DICPUDRAFT_148649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 342 aa AA seqDB search
MLFNSSVTNNHNPNKDIELQGPINDGISCLKFSPKTSNLIVAGSWDQKIRCWEVNTPSLS
SQPRAMISHEAAILCTDWNGDGTQVFTGGVDNKVKLWNLQTNQMVQVAQHNAPVKDCFWI
EESKVLVTGGWDKSIKYWDTRQSTPVLSLDLSERVYAMDCLYPLLVVATADRKIYVYNLQ
NPSVPYKTMESLLKYQTRSIACFGEKNGFALGSIEGRVAIQSFEEKPELSFTFKCHREND
TLAYAVNSISFALPYGTFATAGSDGGFSFWDKESKFRLKQFTKVPQPITCTAFNSDASLY
AYASSYDWSKGSQGFDPNSQSYVFVHPVGDEAKKGNRTAKKR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaatagttcagtcacaaataaccataatccaaataaagatatagaattacaa
ggaccaattaatgatggtatatcttgtttaaagttttcacccaaaacaagtaatttaatt
gtagcaggttcatgggatcaaaagattagatgctgggaagttaacacaccatcattatca
tcacaaccaagagcaatgatcagccacgaagcagcaattttatgtactgactggaatggt
gatggcacacaagtatttacaggtggtgttgataataaagttaaactttggaatttacaa
actaatcaaatggttcaagtcgcacaacataatgcaccagttaaagattgtttttggatt
gaggaaagtaaagttttggttacaggtggttgggacaaatcaattaaatattgggatacc
agacagtcaacccctgttctttcattggatctctcagaaagagtttatgctatggattgc
ctttatccattattagtagttgcaacagcagatcgtaaaatctacgtatacaatctccaa
aacccaagtgttccatataaaacaatggagtcattattaaaatatcaaactcgtagtatt
gcatgttttggtgaaaagaatggttttgctttaggctctattgagggtcgtgttgcaatt
caatcatttgaggaaaagccagaattatcatttacattcaagtgtcatagagaaaatgat
acattagcatacgcagttaactcaatttcatttgcattaccatatggtacttttgcaaca
gcaggttcagatggtggtttcagtttttgggataaagaatctaaatttagacttaaacaa
tttaccaaagtaccacaaccaattacatgcacagctttcaattccgatgcaagcttatat
gcttatgcatcatcatacgattggtctaaaggtagtcaaggttttgatccaaatagtcaa
agttatgttttcgttcacccagttggtgatgaagctaaaaaaggtaatagaacagcaaaa
aaaagataa

DBGET integrated database retrieval system