KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_149003Help
Entry
DICPUDRAFT_149003 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICPUDRAFT_149003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_149003
   00020 Citrate cycle (TCA cycle)
    DICPUDRAFT_149003
   00620 Pyruvate metabolism
    DICPUDRAFT_149003
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DICPUDRAFT_149003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 631 aa AA seqDB search
MLRLVSKQSSRKALKQLVSLEAPVANNTTRTFISTNKIERNICNNKLNIFTSSTTLNKNV
VFTEILSTSSVAKRFYATPGKQITMPALSPSMTEGNIASWKKKEGDQIKAGDVIAEIETD
KATMDFIYEEGNGYLAKILAPEGAKGIEINQPIAIIVSKKEDIEAAKNAKVDSSSSSKPA
EAPKQEAPKPASKPAPKPKSTKTYPSHKVVGMPALSPSMETGGIASWAKKVGDQIKAGDV
VAQVETDKATMDFVYEEGNGYLAKILVPEGTTGVQINQPVFVIASKKEDCDKFADFTAES
NESHEEPAAVESSESSESSTASTTTTSTTTATRAAGERVFASPAARAAAASKGFDVSQIT
GTGPNNRVIKSDVLEFTPQQKQAEAPATAAAKKPTATAAPSTGTFTDFPHSNIRRVTAAR
LTESKQTIPHYYLTMECRVDKILKMRQELNAGNTVKLSVNDFIIKAAAAALRDNPVVNST
WTDSYIRRFHNIDINVAVNTDQGLFTPIVRGADMKGLNAISTTVKSLAEKAHQNKLTPSE
FESGTFTISNLGMFGIKSFSAVINPPQAAILAVGTTETRVVPGTTPGTQYENATILSVTL
SCDHRVVDGALGAEWLKSFKDYMENPLKLLL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgttaagattagtatcaaaacaaagcagcagaaaagctttgaaacaattggtttcatta
gaagcaccagttgccaataataccaccagaacattcatcagcaccaacaaaatcgaaaga
aatatttgcaataataaattaaatatcttcaccagttcaaccactttaaataaaaatgta
gtttttactgaaattttatcaacttcatcagttgctaaacgtttctatgctactccaggt
aaacaaattactatgccagctttatcaccaagtatgactgaaggtaatattgcttcatgg
aaaaagaaagaaggtgatcaaattaaagccggtgatgttattgccgaaattgaaactgat
aaagctactatggatttcatttatgaagaaggtaatggttatttagctaaaattttagcc
ccagaaggtgccaaaggtatcgaaattaatcaaccaattgctattattgtttcaaagaaa
gaagatattgaagctgccaaaaacgctaaagtagattcatcatcatcttcaaaaccagcc
gaagctccaaaacaagaagctccaaaaccagcttcaaaaccagctccaaaaccaaaatca
actaaaacttatccatcacacaaagttgttggtatgccagctttatcaccaagtatggaa
actggtggtattgcttcatgggctaaaaaagtaggtgaccaaattaaagctggtgatgtt
gttgctcaagttgaaactgataaagctactatggatttcgtttatgaagaaggtaatggt
tatttagccaaaattttagttccagaaggaaccacaggtgttcaaattaaccaaccagtt
ttcgttattgcctcaaagaaagaagattgtgataaatttgctgatttcactgctgaatca
aatgaatcacacgaagaaccagccgctgttgaatcatcagaatcatcagaatcatcaact
gcctccaccaccaccacctccacaaccactgccacccgtgctgccggtgaaagagtattt
gcctcaccagctgctagagctgctgccgcctcaaaaggttttgatgtttcacaaattacc
ggtactggtccaaacaacagagttattaaatcagatgttttagaattcaccccacaacaa
aaacaagctgaagccccagccaccgctgctgccaagaaaccaaccgctactgccgcccca
tcaactggtacctttaccgatttcccacacagcaacatccgtagagttactgctgctcgt
cttactgaatctaaacaaactattccacattactatctcactatggaatgtcgtgtcgat
aagatccttaagatgcgtcaagaattaaacgctggcaacactgtcaaactctcagttaac
gatttcattattaaagccgccgctgctgcccttagagataatccagttgtaaactcaacc
tggaccgattcatacattagaagattccacaacattgatattaatgttgctgtcaacact
gatcaaggtttattcaccccaatcgttagaggtgccgacatgaaaggtctcaatgccatt
agcactactgttaaatcattagccgaaaaagctcaccaaaataaattaactccatcagaa
ttcgaaagtggtacattcactatttccaacttaggtatgtttggtattaaatcattcagt
gctgtcattaatccaccacaagctgccattttagccgttggtaccaccgaaacccgtgtt
gttccaggtactactccaggtactcaatatgaaaatgctactattttatctgttacctta
agttgcgaccatcgtgttgttgatggtgctttaggtgccgaatggttgaaatcattcaag
gattacatggaaaacccacttaaattattattataa

DBGET integrated database retrieval system