KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_149471Help
Entry
DICPUDRAFT_149471 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1948 aa AA seqDB search
MDVELFEDPVEKLKYNIITEEPNALNKFLQIQKHNFTDAKRFISLKSKGPDSANIRNELN
QKKSFPYKTDSVNAGDAFLAIAYKFSDRFNIDEFLSCRILYHIFEHSSTRNEIQLLEQSE
KFIFQNRSCYLQFLREILFTLQGEVGSKLKHDTLQQFVGDLISEQSNEKNILNILIKTLE
EKVSSMNVTANPLECSYRIKECTQIAETLFLISVQFTIREDIIKLIIRSLNLCIEKQVDQ
ILKNSLFEIIFLQYFTLFSIFDGTKNSRVYNPIEKRFTHNHIERPDEIENEIQQIQQTQD
IKPSLLLIYNLVYKDIKGDSDRFGNQGISNKLPFEGDPYIFLLNVVQAKEFQVSQLTLFL
SSFINILSCKYITFLPEKQSIRLASNAEVVNNFNFVMANIFDNQLINSHEFWRRGEETGY
FGNYLWFQIPDHIIISSFRLMGSLARSNTVEVYNFFATSGQFSWHKLFQDINSYVKSLNG
SNSFDIAPKDIDVLTNILLLVARLVESSIQVSVMITKTHPIIGIAVQFSLFQVETKLKSA
ALRLITAFSKYTNYLGDIWKFCTIDTQLLRIGLSLTGGSNDLPIAQQSLELLSTIIHNSS
NFIFDKNSSESVRLTNYLDQCMELFNFIDNKSFNNFDEKWKFALSIVKIFEYCLKQFNAS
GVNNCVIDKCHPVYKLFFELNRKSKTLENIIKIIDFANDQASHIKNTIDIQQQEQQQHYQ
QQLLSSNSSPQQQQYLQQQKNLSETNYYTLQVLQEQKQQDNEVFRVLLNKCLDILLLVSD
STVLSIDDAKCLVSNLSNMNKSKPIVSITKLIDYESPAVALRALRLVYSFETYTRRISTV
FLENNPDDIILRFVKMMEYNETNFEDFSGSVYTQYVNFALYTSSSVQWTIAQLILLCLSE
CQPNTYTLGHFLLGCCSNIDLSKDFVPNSRSCLTLILKHVQDAQFVERYPHLVECFHEII
YKMVKDPVTYSPMLKFINEEYPSYYRNSMEVLTNSIAINGGSERKLETLISSLSWVLNSC
AISIQNYFSLDMKQFLSNYIFPAMNIHSTMMIMSSINVLTLYNTIEYPMANLEVSQPRLF
SIYPQLDSNNCANSPIFQTSPNGITLLNIPKVRELLESDRNRFSNQFEIDKELEDCCYSN
LTYQLVNAKKRALESWKSFVMVSLCQNTIEIEVLDENLLLSLLQRIVTDFANERKPVESC
LAIGNTITTILSILKDKKQNYQLFSQTMSAGENDIIEQKMKLILEGLLQAVLKSPHYIIR
GLSYICLIQYLDLTEQPPAASSSSSSPSSPSSLQQQEQIQLINDLNLNLVSKIEDKFIRT
LSSDCTSFSRGWRIAALSCLQAILSVDNLCGHRTLLFLQNKGFIINMIVYTSNFLSNDWE
NIESKDLYVYRSQMSLLLKISQQMDGVHILINNGVIKTFVDSSFLNYIPTDKISNKFSEI
LLPILKLFASLCLYYGNHSNHSGHHNDKHEIYQDIFNFLMNHSELFTIILSDNNKEEEYY
TYKNLEILKLTCYLFSKVSFVFFKKQSQQDQSKEKARFLRFHYCLTNLLIKYSTNSKKII
EKTIPDDKDQEELASKIDFSYSAANNIKHHDALNKKKNQFQILIKQMICSITHDLLMYCR
KVSILTDQRIGFTCFNSNLNILNFGSSFSRSNQNSMVSNPSGSISSNSKLLPSLDLAINF
LIDNIIQYTFYKMDSNQCQKLLDNYEQLTYVQYQEILQNSDTLTPSQRNHMVLNILKQKI
NDIETQISTIFDNIELLLILIVTHSYYFSNQLGILFQSNQISPVLSSSQFNHNNNSKFEI
SDLNNSTIGNKQQQQQTTNRNGDVFLQSKPHQNGGVLSSVFSIFKSHQENPPKISMNQTP
AQNQQSLTNSRMVLPLQQSQLSQPHTPPQSELSNQEIDTFLKRLKQSIFDREINQLGGIK
LSDAILNRLDKKSTIIDLMLKKLQDLTK
NT seq 5847 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagaattatttgaagatccagttgaaaaattaaaatataatattataacagag
gaaccaaatgcattaaataaatttttacaaattcaaaaacataattttacagatgccaaa
cgtttcatttcattaaagagtaaagggccagatagtgctaatattagaaatgaattaaat
caaaagaaaagctttccatacaaaacagactctgtcaatgctggtgatgcttttttagca
attgcatataaattttcagatagatttaatattgacgagtttttaagttgcagaatttta
tatcatatattcgaacatagttcaaccagaaatgaaattcaattattagaacaatctgaa
aaatttatttttcaaaatagatcatgttatttacaatttctaagagaaattttatttaca
ttacaaggcgaagttggttctaaattaaagcatgatacattacaacagtttgttggtgat
ttaatttcagaacaaagcaatgaaaagaatatattaaacattttaattaaaactttagaa
gaaaaagtatcatcaatgaatgttacagcaaatccattagaatgctcctatagaattaaa
gaatgtacacaaatcgcagaaaccttgtttttaatttcagttcaatttacaattagagaa
gatattattaaattaattatcagatcattaaatttatgtatagaaaaacaagttgatcaa
attttaaagaattcattatttgaaattatatttttacaatacttcacactcttttcaatt
tttgatggcacaaaaaatagcagagtttataatccaattgaaaaacgttttactcataat
cacattgaacgtccagacgaaattgaaaatgaaattcaacaaattcaacaaactcaagat
attaaaccatcattattattaatttataatcttgtttataaagatattaaaggtgatagt
gatagatttggtaaccaaggtatttcaaataaattaccatttgaaggtgatccatatata
tttttgttaaatgttgttcaagctaaagaatttcaagtttcacaattaactttattttta
agttcatttataaacattttatcttgtaaatatataacatttttaccagaaaagcaatct
attagattagcttcaaatgctgaagttgtaaataattttaattttgtaatggcaaatatt
tttgataatcaattaataaattcacatgaattttggagaagaggtgaagaaactggttat
tttggaaattatttatggttccaaattccagatcatattatcatttcatcatttagatta
atgggttcattagcaagatctaatactgttgaagtctataatttctttgctaccagtggc
caattttcatggcataaattattccaagatataaattcctacgtcaaaagtttgaatggt
tcaaatagttttgatattgccccaaaagatatcgatgttttaaccaatattttgttatta
gtagcccgtttagttgaatcttcaattcaagtttctgtaatgatcacaaaaacccatccc
ataattggtattgctgttcaattttcacttttccaagtcgagaccaaattaaaatctgca
gcattacgtcttattacagcattttcaaaatacaccaattatttaggcgatatttggaag
ttttgcacaatcgatactcaattactcaggattggtctctctttaactggtggttcaaat
gatttaccaattgctcaacaatcattagagttactctcaactattattcacaactcctca
aactttatttttgacaaaaatagttcagaaagtgttagattaaccaactatttagatcaa
tgtatggaactttttaattttatcgacaacaaatcattcaacaactttgatgaaaagtgg
aaatttgctttatctatcgtaaagatatttgaatattgccttaaacaattcaatgcctct
ggtgttaataattgtgtcattgataaatgccatccagtttacaaattattttttgaatta
aacagaaaatcaaaaactttagaaaatattataaagattattgactttgctaatgatcaa
gcttctcacatcaaaaatacaatcgatatacaacaacaagaacaacaacaacattaccaa
caacaacttttatcatcaaactcttcaccacaacaacaacaataccttcaacaacaaaaa
aatttatcagaaaccaattattacacattacaagtgttacaagaacaaaagcaacaagat
aacgaagtttttagagtcctcttaaataaatgtttagatattctcttattagtctctgat
agtaccgtcctttcaattgatgatgccaagtgtttggtttcaaatctttcaaatatgaat
aaatctaaaccaatcgtctcaattaccaaattaatcgattatgaatcaccagcagttgct
cttagagctcttagattagtttattcattcgaaacttatactcgtcgtatttcaacagtt
ttccttgaaaataatccggatgatattattctaagatttgttaagatgatggaatacaac
gaaactaactttgaagatttctcaggtagtgtctatacccaatatgtcaattttgcatta
tatacatcaagctcagttcaatggactatcgctcaacttattctcctttgtctctcagag
tgccaaccaaatacttatacccttggccacttccttttaggctgttgctcaaatattgac
ctctctaaagattttgtaccaaatagtagaagttgtttaactcttattctaaaacacgtt
caagatgcccagtttgttgaacgttatccacatttggttgaatgtttccatgaaattatt
tacaaaatggttaaagacccagtcacctattcaccaatgctcaagtttatcaatgaagaa
tacccatcatattatagaaattcaatggaagttttaacaaactctattgctatcaatggt
ggttcagaaagaaagcttgaaactttaatttcatctttatcatgggtattaaacagttgt
gcaatttcaattcaaaattatttttcactcgatatgaaacaattcctttcaaactacatt
ttcccagcaatgaatattcattcaaccatgatgatcatgtcatcaattaatgtacttact
ctttataacacaatagaatatccaatggctaaccttgaagttagccaaccaagacttttc
tcaatttatccacaacttgactccaataattgcgcaaattcaccaattttccaaacctca
cctaatggcatcacattattaaatattccaaaagtccgtgaactcttagaaagtgaccgt
aacagattctcaaatcaattcgaaattgacaaagagttagaggattgctgctattcaaat
ttaacttatcaattggtcaacgctaaaaaacgtgctttagaaagttggaaatcatttgtt
atggtatctctctgccaaaataccatcgaaattgaagtattggacgaaaatttattactc
tcacttttacaaagaattgttacagattttgctaatgaacgtaaaccagtcgaatcatgt
ttggccattggtaataccattacaaccattctttcaattttaaaagataaaaaacaaaac
tatcaattattttcacaaacaatgtccgctggtgaaaatgatattatcgaacaaaaaatg
aaattaattttagagggtctcttacaagctgtattaaaatcaccacactatatcattaga
ggtctcagttatatctgtctcattcaatatttagatttaacagagcaaccaccagcagcc
tcatcttcatcttcgtcaccatcatcaccatcatcattacaacaacaagagcaaattcaa
ttaattaatgatttaaatttaaatttggtttctaaaattgaagataaatttattcgtacc
ctttcatcagattgtacttcattcagccgtggttggagaatagccgctttaagttgtctt
caagcaatactttcagttgataacttgtgtggtcatcgtactttattattccttcaaaac
aaaggtttcattattaatatgatagtctacacctcaaatttcttaagtaatgattgggaa
aatatagaatcaaaagatctttatgtctatagatcccaaatgtcacttctcttaaaaata
agtcaacaaatggatggtgttcatattttaattaacaacggtgtaatcaaaacttttgta
gattcttcattccttaattacattccaaccgataagatctccaacaaattttcagaaatt
ttattaccaattcttaaattattcgcttcactctgtctctactatggaaatcatagtaat
cattccggtcatcacaacgataaacacgaaatttatcaagatatcttcaatttccttatg
aatcattcagagcttttcacaattattttatcagataacaacaaggaagaagaatactat
acttacaagaatttagaaatattaaaattaacctgttatctcttttctaaggtttcattt
gtattctttaaaaaacaatcacaacaagatcaatctaaagaaaaagctagattcctcaga
ttccattactgcttaaccaatcttttaattaaatactctaccaatagcaaaaaaataatt
gaaaaaaccattccagatgataaagatcaagaagaacttgcttctaaaatcgactttagt
tattcagcagcaaacaacattaaacaccatgatgctttaaacaaaaagaagaatcaattc
caaattttaattaaacaaatgatctgttcaattactcatgatcttcttatgtattgcaga
aaagtttccattttaactgatcaaagaattgggtttacttgtttcaattcaaatttaaat
attttaaatttcggtagcagcttttcaagatcaaatcaaaatagtatggtctcaaaccca
tctggatcaatttcttcaaattctaaattattaccatctttggatttagcaatcaacttt
ttaattgataatataattcaatatactttttataaaatggattcaaaccaatgccaaaaa
ttattggataactatgaacaattaacctatgtccaatatcaagaaattcttcaaaactct
gatactcttacaccatctcaaagaaatcatatggttttaaatattttgaaacagaaaatc
aatgatatcgaaactcaaatctcaaccattttcgataatattgaattacttttaatttta
attgtaactcattcctactatttcagtaatcaattgggcatattattccaatcaaatcaa
atttcaccagttttatcatcctcacaattcaatcacaacaataacagtaaatttgaaatt
agcgatttaaataatagtaccatcggtaataaacagcaacaacaacaaactacaaataga
aatggtgacgtatttttacaatcaaaaccacaccaaaatggtggtgttttatcatcagtt
ttctcaatatttaagagccatcaagaaaatccacctaaaatctcaatgaatcaaactcca
gctcaaaaccaacaatcattaactaatagcagaatggttttaccattacaacaatctcaa
ctttcccaaccacacactccaccacaatctgaattatcaaatcaagaaattgatacattc
cttaaacgtttaaaacaatccattttcgatagagaaattaatcaacttggtggtattaaa
ttatctgatgcaattttaaatcgtttagataaaaaatcaaccattattgatttaatgctc
aaaaaattacaagatttaacaaaataa

DBGET integrated database retrieval system