KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_149892Help
Entry
DICPUDRAFT_149892 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DICPUDRAFT_149892
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    DICPUDRAFT_149892
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     DICPUDRAFT_149892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1602 aa AA seqDB search
MKTLPINNTNNNKNENNHNNDHHMIIGSMSSVGSIEDIDIDSEPPPITINLQRPNTSNNS
CITVVLEKDNCTDIKSVIENLKVQLESTIKDLNFFKDNFEQIETNNQIKEWSYFIHNIKS
NSLNNSNVYLTIPTSLTSSASSSSLTSLTSAPASLNNSGNNIIIASPDSLKSNEISKDSK
TSNNVPLALTQKHQPNNNNKTNEEENTNSEVDNIQITNYTQGPSIITQMKKRFENKIKNS
NLNLNTSNSNNNSNSNNNNNNNNNMNNMNKDNNFSTSLSPPISPPISPPISPPISPPSSP
PSSIISQSLATSSVLNPLSVTKRMNKIKTWTSTKPSSSSINFGSSVKTSSLNITGSSRFF
TSRQDSSKLMVNSSSGSNVSVPSSPPSSPLVNPQSPNVLNEEEINETNNNNELTVEEEEL
KKQILKERQENDLLKKKQYFSKGYFVKTCNASHDDCTEEEEIPINEDHWETNVIVVLPCR
HHVKVPGSSSSTIESIRQLAWASGKMQGHINLDKDEKSFTLKWCNKDCAFDQDTPLLHLV
QYNLNYNTQKVGNIKLELVLEDELCKERLVDLQSLEINNGKPSYWKSHIDEVLRFNKVLR
DIAIFANPQFNSIICARTSPYPPPQSIPEFFVIRVHIKDQTKSLRCSNNHTALSLMTILS
EKLKNTIPFNPTEYLFIITGINQYINPNLNLLSVEYILEKIKRKGEIDLTIININQLNNN
QLLKLKQDNSNNSIDKQESNSTLDNVKLLSKESSKLINLLLNNNNNSNCNNNNNNKLKNN
INSDNENQYIKSILIEENLKVRLLHAHEIFSSNIYEIIGSESTNIQIYIEVSLYFGGELL
ATQNSRLVSYQDTVVWNEWIEVPISVSNIPNGSRMCLGLHAKYRGEIYPIGWVGHRLFDS
KGILNTFAPFSLLLWPGKINPIGSCVDNLESKDQAIIIAFEFKEYFVPKIIYYENDIIGH
LKSLEKDKESNSELPSALPSVTTEDMDRVEQIMLQDPLYRLTKEEKELFWKTRYFCQTKP
QTLSKLLQSVEWTDYRQVGEAYQLLEIWPILPAVDALELLDPKFADSVEIREYAVKCLDQ
MSDYELEIYLLQLVQAIKHDVFHGSVLSLFLIGRVLQNIDLLGHYFFWHLRADIDNQEVC
ERFRVLSSAFLRYAPPLLGEELKKEITTLRILENLSKRVREVPYEKRKQYVESHLTEEQN
FPKDILIPYDPSIKVLNIVPQKCKSMDSAKVPLWVTFKNSDSFAPPLQMMVKTGDDLRQD
ILTLQLLRLMDHMWKSHDLDLHMTIYRCIATGVGTGLIEIVPNSETAARIQAAAGGFSGA
FKQTPIANWLKNHNQTENNYQKAVSKFTHSCAGYCVATYVLGIGDRHNDNIMIDKYGHLF
HIDFGHFLGNFKTFAGFQREKAPFVLTPDFVYVIGGKDSKNFNYFIDICCKAYNIVRNNA
HIFINMFELMLSTGIPELKSESDIVYLRDKFRLDLNDIEAADYFKKLIHESIGTLTTQLN
FAFHIFYHRANLVNGQEKSTNNVSSSLVYGSSSNSSNSSSLNLLKSSSANNNNNNGSGNN
SGSSTPRETSRIDKSEIKKNIKNIEYEKDEDTVRSIDKDENK
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaattaataatactaataacaataaaaatgaaaataaccacaataat
gatcatcatatgataattggatcaatgtccagcgttggaagtatcgaagacattgacatt
gattcagagccaccaccaatcacaatcaatttgcaaagaccaaacactagcaataattcg
tgcattacagtcgttttagaaaaagataattgcacagatataaaatcagttatagaaaat
ttaaaggttcaattagaaagtacaataaaagatttgaattttttcaaagataattttgaa
cagattgaaacaaacaatcaaattaaagaatggtcatattttattcacaatattaaaagt
aattcattaaacaattcaaatgtttatttaaccataccaacaagtttaacatcatctgca
tcatcatcatcattaacatcattaacatcagcacctgcatcattaaacaatagtggtaat
aatatcatcattgcttcaccagattcattaaaatcaaatgaaatatcaaaagattcaaaa
acctcaaataatgtaccattagccttaacacaaaaacatcaaccaaacaacaataataaa
accaatgaagaagaaaatacaaattctgaagttgataacattcaaattacaaattatact
caaggtccatctataataacacaaatgaaaaagagatttgaaaataaaattaaaaatagt
aatttaaatttaaacacaagtaatagtaataataatagtaatagtaataataataataat
aataataataatatgaataatatgaataaagataataatttttcaacatcattatcacca
ccaatatcaccaccaatatcaccaccaatttcaccaccaatatcaccaccatcatcacca
ccatcaagtattatatcacaatctctagctacatcaagtgtattaaatcccttatcagtt
acaaaaaggatgaataaaattaaaacatggacatccaccaaaccttcttcatcatctatc
aattttggatctagtgttaaaacttcatcactaaatattactggttcaagtagatttttt
acatccagacaagatagttcaaaattaatggttaatagtagtagtggtagtaatgtttca
gtaccatcctcacccccatcttcacctttagtaaatcctcaatcaccaaatgttttaaat
gaggaagaaataaatgaaactaataataataatgaattaacagttgaagaagaagagtta
aaaaaacaaattttaaaagaaagacaagaaaatgatttattaaaaaagaaacaatatttt
tcaaaaggttattttgtaaagacatgtaatgcatcacatgatgattgtacagaggaagag
gagataccaattaatgaagatcattgggagactaatgttatagtagttctaccatgtaga
catcacgttaaggtaccaggttcatcaagtagcactatcgagtctattagacaattagca
tgggcaagtggtaaaatgcaaggtcatatcaatttagataaagatgaaaaatcatttaca
ttgaaatggtgtaacaaagattgtgcctttgatcaagataccccgttacttcatttggta
caatacaacttaaattataatactcaaaaggtgggcaatattaaactagagttggtattg
gaggatgagctatgcaaggaaagattggtagatttacaaagtttggaaattaataatggt
aaaccaagttattggaaatctcatattgacgaggttttaagatttaataaggttttacgt
gacatagcaattttcgcaaatcctcaatttaatagtattatttgtgcccgtacatcaccc
tatccaccacctcaatctattccagagttttttgttattagagttcacattaaagatcaa
actaaatcacttcgttgctccaataaccatacagctttaagtttaatgacaatcctttcc
gaaaaattaaaaaatacaatacccttcaatcccacagaatatttgtttataattactggt
ataaatcaatatattaatccaaatttaaatttattatcagtagaatatatattagaaaaa
attaaaagaaaaggtgaaattgatttaacaattataaatattaatcaattaaataataat
caattattaaaattaaaacaagataatagtaataatagtatagataaacaggaatcaaat
tcaactttagataatgttaaattattatcaaaagaatcatcaaaattaataaacttatta
ttaaataataataataatagtaattgtaataataataataataataaattaaaaaataat
atcaatagtgacaatgaaaatcaatatattaaatcaattttaattgaagaaaatttaaaa
gtaagattgttgcatgctcatgaaatattttcaagtaatatttatgaaattataggtagt
gaatcgaccaatatacaaatatatatagaagttagtctttattttggtggtgaattactg
gcaacccaaaatagtagattggttagttatcaagatacagtagtttggaatgaatggata
gaggtaccaatttcagtatcaaatataccaaatgggtctcgtatgtgtttgggtttacat
gcaaagtatcgtggtgaaatttatccaattggttgggttggtcatagattgtttgattct
aaaggtattttaaatacatttgctccattctctttattgttatggccaggtaaaataaat
ccaataggaagttgtgtagataatttagaatctaaagatcaagctatcattattgcattc
gaatttaaagaatatttcgtcccaaagatcatctattatgaaaatgatattattggtcat
ttaaagagtttggaaaaagataaagaaagtaactccgaattgccatcagcattaccatct
gttaccacagaagatatggaccgtgttgaacaaattatgcttcaggatccattatatcga
ttaacaaaggaggaaaaagagttattttggaaaacacgttatttttgccaaactaaaccc
caaacactttcaaaattacttcaaagtgtcgaatggacagattatagacaggttggtgaa
gcttaccagttattagaaatttggcctattttacctgctgtagatgctttggagttattg
gatcccaaatttgcagattctgtagagattagagagtatgctgtaaaatgtttagatcaa
atgtcagattacgaattagagatttacttgttacaattagtacaggctatcaagcatgac
gtattccatggctcagttttaagtctctttttaattggcagagttttacaaaacatcgac
ttgttgggccattatttcttttggcatttacgtgccgatattgacaatcaagaggtttgt
gaaagatttagagtactcagttctgctttcttacgttatgctcctcctcttttgggtgaa
gaacttaaaaaagaaattacaactcttcgtattttagaaaatttatcaaagcgtgttaga
gaagtgccatatgaaaaaagaaagcaatacgtcgaatcacatttaaccgaagagcaaaat
ttcccaaaagatatattaataccctacgatccatctatcaaggttcttaatattgttcca
caaaagtgtaaatcaatggattcagctaaagtgccattatgggtaacattcaaaaactct
gactcattcgctccacctcttcaaatgatggtcaaaacaggtgatgatttaagacaagat
attctcactttacaactattaagattaatggaccacatgtggaaatctcatgatttggat
ttacatatgactatttatcgttgtatagcaacaggtgttggtacaggtttaatcgaaatt
gttccaaactcggaaactgctgcaagaatccaagcagctgctggtggttttagtggtgca
ttcaagcagactccaatcgctaattggttaaagaatcataatcaaacagaaaacaattac
caaaaggcagtttccaaatttactcattcttgtgctggttattgtgttgcaacctatgta
ctcggtataggtgatagacacaacgataacattatgattgataaatatggtcatcttttc
cacatcgattttggtcacttccttggtaattttaaaacatttgctggtttccaacgtgaa
aaagctccatttgttttaacacccgatttcgtttatgtaattggtggtaaggattctaaa
aatttcaattactttatcgatatttgttgtaaagcatataacattgttagaaataatgct
catatatttataaatatgtttgaattgatgttatcaactggtattcctgaacttaaaagt
gaaagtgatattgtatatttaagagataagtttagattggatctcaacgatatcgaagct
gcagattacttcaaaaaattaatacacgaatcaataggtacattaacaacccaacttaat
tttgcttttcatatattttatcatagagcaaatcttgtaaatggtcaagaaaaatcaaca
aacaatgtcagcagtagtttagtttatggtagtagttcaaacagttcaaatagtagtagt
ttaaatttattaaagagtagtagtgcaaacaataataataataatggcagtggaaacaat
agtggcagtagcacaccaagagagactagtagaattgacaaatcggaaattaaaaaaaat
attaaaaatatagaatatgaaaaagatgaagatacagtcagatcgatagataaagatgaa
aataaataa

DBGET integrated database retrieval system