KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_150684Help
Entry
DICPUDRAFT_150684 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DICPUDRAFT_150684
Enzymes [BR:dpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DICPUDRAFT_150684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1340 aa AA seqDB search
MNNGYHITNNYNSENSNVATATDNTLKDNNYENNNISTNNNYNNNSNNNNNSGNINNINH
DEFELEGIKTVNNYDVFSSEDESFRHSGPALGKKRKFTDPDELDSVNKNPNSTLNGHSED
LSKSKYLQTIRESLVKPKFTNPEIDKSLIRYPIKSRGGNWKNIEEDNRNKSDPQKVINRL
RVNGFLYDHDTNDSISLQLSDPRDKYEIDRMNQLKQSSQVELIIPSFFKTAHIINTKKGT
ERLIKDMGISEYGGYNIEGETGDWMNHLKQQIHQIEQPPPPPPPPSPPPPTQFNYIPHSP
TTHLQQPYYGYPPQQPPQSQQPVYSHHLYYQQQQLQQLQQQHQQQHQQQQQQHQQQHQLQ
QPPPPPIPQQQHYQPHNEYYNPRHPTEPLTPKQDSYPHFSFSKISNNEYGNNLTPNRSYR
DREWDRDREWDRSSYGRDHFHSSPHTIAANSVPPTPTNNSLQSSTNSIMAMEIGTATPPI
NTSTPTIAPTLNPSTTPSLIRPSGLSRGEPVLNSNINNNSIVNSKETEKTPSIPKKKSKF
STPKPSPYSIQIPMLPDEKLLKEATTTATGFNSTSIILGKEKKKYSDRLMSHFKIFDPVN
VYLDESFWYIDFRSADSRDRAISVLNGTYINDWKLNVDIKKTKAINIELLKEQQKEEEDL
EKGIKPKIKTFNIQENEHILKEICKILVSTELLTTSSKDIAKTFVESEIFKQIKEIDSQR
PEPTPTIPSAKEKKSSSSNREKKPPPSSTITTSTAGSKLDIANIPSFRKPEKKTKNHFYS
DESESSDEESKYSLSSASPSPRSPVKEKKLTSHQTTARKALLYSDDEEDELHQEDQELEN
IDVENVTAGQRNNKYLSDSEDQFSSHSEDNINGTTINNYESMSLSEDDYSSDDEPVNKKR
GGKKDSKSKSKSSKKSKSKSRDSSSKGTKKKSISTTTTTTITKLAKTTITKKKTNSNKLI
PTDIINSNLTPRDEEDAFYLKQVMNDASTIQQLLSTKSEEDFEDNESIGTMNSSLSPRPA
TPSSQPPSTTINKTSNKSKVLKSLEDSSEEENLMNDNQLVSVFKKQPEQEEEEEEEEEQE
EPINRETDESIINKSFDNIDISNTHVSQTGCARTEGYTRDDIQKYFKKKVIAPVGKRGAA
LSSASDSVPLTSLSSPANNGNNSNAAADFDVASRSARSSRFDSRFQGSDSVTLASLKSRR
KKIKFQRSDIHDWGLFAMETINAKDMVIEYIGEVIRQKVADEREKRYIKKGIGSSYLFRV
DDDTIIDATLKGNLARFINHCCDPNCIAKVLTINNQKKIIIYAKRDINIGEEITYDYKFP
IEDEKIPCLCKSPKCRGTLN
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgaataacggttaccatattaccaataattataatagcgaaaatagtaatgtagcaaca
gcaaccgataatacactcaaagataataattatgaaaacaacaatatcagtaccaataat
aactataataacaatagtaacaacaacaacaatagtggcaatataaataatataaatcat
gatgaattcgagttagagggtattaaaacagtaaataactatgatgtattttcatcagag
gatgaaagtttccgccatagtgggccagcgttaggaaagaaaagaaaattcacggaccct
gacgaactagactctgtaaataaaaatccaaattcaacattaaatggtcacagtgaagat
ttaagcaaatcaaaatatttacaaacaataagagaatcattagtcaaaccaaaatttaca
aatcccgagatagataagagtttaatccggtatcctataaagtcccgtggtggtaattgg
aagaacatcgaagaggataatagaaataaatcagatccacaaaaagttataaatagatta
cgggtcaatggttttttatatgatcacgatacaaatgattcaatttcattacaactaagt
gatccaagagataaatacgaaattgatagaatgaatcaattaaaacaatcttcacaagtc
gaattaataattccttcattttttaaaacagctcatattataaatactaaaaaaggaact
gaaagattaattaaagatatgggtatctcagaatatggaggatataacatagagggtgaa
acaggtgattggatgaatcatctaaaacaacaaatacatcaaatagaacaacctccgcca
ccaccaccaccaccatctcctcctccaccaacccaatttaattatattccacattcacca
actactcatttacaacaaccttactatggatatccaccacaacaaccaccacaatcacaa
caacctgtttattcacatcacttatattatcaacaacaacaattacaacaactacaacaa
caacatcaacaacaacatcaacaacaacagcaacaacatcagcaacaacatcaactacaa
caaccaccaccaccaccaataccacagcaacaacactaccaaccacataacgaatattat
aacccaagacacccaactgaaccattaacgccaaaacaagattcatatccacatttttca
ttttccaaaatttcaaataatgaatatggtaataatttaactccaaatagatcatacagg
gatagagaatgggatagagatagggagtgggatagatcatcatatggtagagaccatttt
cattcatcaccacatactatagcggcaaactccgttccaccaacacccacaaataatagt
ttacaatcgtccaccaactctataatggcaatggagattggaacagcaacaccaccaata
aatacatcaacaccaacaatagcaccaactctaaaccctagtacaactccatcattaata
agaccaagtggattatcaagaggtgaacctgtattaaatagtaatataaataataatagc
attgtaaattcaaaagaaactgaaaaaactccttctataccaaaaaagaaaagcaaattc
agtacaccaaaaccgtcaccctattctattcaaataccaatgttacctgatgaaaaatta
ttaaaggaggcgacaacaacagcaacaggttttaatagtactagtattatattgggtaaa
gagaaaaagaaatattccgacaggttaatgtcacattttaaaatctttgatccagttaat
gtatatttagatgaaagtttttggtatattgattttagatccgctgattctagagacaga
gcaattagtgtattaaatgggacttatataaatgattggaaattaaatgtagatataaag
aaaacgaaagcaatcaacatagaactattaaaagaacaacaaaaagaagaggaagatctc
gaaaaaggaattaaaccaaaaataaaaacattcaatatccaagagaatgaacatatctta
aaagaaatttgtaaaattttagtcagcacagaactattaacaacctcatccaaagatatt
gcaaaaacttttgtagagtctgaaatttttaaacaaattaaagaaattgattctcaaaga
ccagaaccaactccaacaattccttcagctaaagaaaagaaatcatcctcatcaaataga
gaaaagaaaccaccaccatcttcaacaattacaacctctacagcaggctctaaacttgat
attgccaatataccatcatttagaaaaccagaaaagaaaacaaagaaccatttctatagt
gacgaaagtgaatcaagtgatgaggaatctaaatatagcttatcatctgcatcgccatcc
ccaagatcaccagtcaaagaaaagaaacttacctcgcatcaaacaacagccagaaaagct
ttattatactctgatgatgaggaagatgaacttcatcaagaagaccaagaattagaaaat
attgatgttgaaaatgttacagcgggtcaaagaaacaacaaatatttatcagattctgaa
gatcaattttcatcacacagcgaggataacattaatggaactactataaacaactatgaa
tctatgagtttatcagaggatgattatagctcagacgatgaacctgtaaataaaaaaaga
ggaggcaaaaaagattcaaaatcaaaatcgaaatcaagtaaaaaatcaaaatcaaaatct
agagattcttcttctaaaggaactaaaaagaaatcgatatctacaacaacgacaacaaca
atcacaaaattagccaaaacaaccattactaaaaagaaaaccaatagtaataagcttatt
ccaacagacattataaactcaaatttaacaccaagagacgaagaggatgcattttattta
aaacaagtaatgaatgacgcctcaaccatccaacaacttttatctacaaaatctgaggaa
gactttgaagataatgaaagtattggtacaatgaatagtagtttatcacctcgtccagcc
acaccatcatcacaaccaccatccactacaattaataaaacatcaaataaatcaaaagtt
ttaaagagtttagaagatagctctgaagaagaaaatttaatgaatgataatcaattagta
agtgtatttaaaaaacaaccagaacaagaagaggaagaggaagaagaagaggaacaagaa
gaacctatcaatagagaaactgatgaaagtattataaataaaagttttgataatattgat
atatcaaatactcatgttagccaaaccggttgtgctcgtaccgaagggtataccagagat
gatattcaaaaatattttaaaaagaaagttattgcaccagtgggtaaaagaggggctgca
ttatcatcagcatccgactctgtaccattaacatcactttcatcaccagcaaacaatggt
aacaatagtaatgcagccgcagatttcgatgtggcatcaagatcagcaagatcatcaaga
tttgatagtagatttcaaggctcagactctgttacattagcatcactaaagtcaagaaga
aaaaaaatcaaattccagcgttctgatattcatgattggggtcttttcgccatggaaact
attaatgcaaaggatatggtcatcgaatatattggcgaagttattcgtcagaaagtagca
gatgaaagagaaaagcgttatataaagaaaggtattggtagtagctatctctttagagtg
gatgatgacactattatcgatgcaactctcaagggtaatcttgctagattcattaatcat
tgctgtgacccaaattgtatagctaaagttttaacaatcaacaaccaaaagaaaattatt
atctacgcaaaaagagatattaatattggtgaagaaattacttatgactacaaattccca
atcgaagacgaaaaaataccttgtttatgtaaatctccaaaatgtagaggtactcttaat
taa

DBGET integrated database retrieval system