KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_151030Help
Entry
DICPUDRAFT_151030 CDS       T02090                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICPUDRAFT_151030
Enzymes [BR:dpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DICPUDRAFT_151030
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C44
   DICPUDRAFT_151030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 554 aa AA seqDB search
MCGILAILNSLEDPSKLRKKALSLSSRLRHRGPDWNGIFQTKDSVLTHERLAIVGLENGA
QPLLNEDETIALTVNGEIYNHEQLREELIATGKHTFKTHSDCEPILHLYEDKGDDFVHLL
NGDFAFVVYDSKANTFLAARDPIGVVPLYIGWSKDGAVWFASEMKALKDDCYRFEAFPPG
FYYSSKTKEFVRYYKPDWIMGAEPQPSTEEQVLPLIKDAFEKAVVSRMMSDVPYGVLLSG
GLDSSLVASIVSRHAEKRIEDHEQSRAWWPRIHSFCIGLKDAPDLKAAREVASFLGTVHH
EYNFTVQEGIDALSDVIKHLETYDVTTIRASTPMYFLSRKIKAMGVKMVLSGEGSDEIFG
GYLYFHNAPDANEFHSECVRRIKALHSFDCLRANKSTAAWGVEVRVPFLDQGFLQTAMSV
SPTHKVCTDAEGKKRMEKYILRKAFESKEKPYLPDSVLWRQKEQFSDGVGYSWIDGLKEY
AESEITNEEFAKRETYFPDDTPDTKEAFLYRRLFEQLFPGKECRETVQHWVPKWSTSTDA
SGRAQKIHDQHKDI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattttagcaattttaaactcattagaagatccaagcaaattaagaaagaaa
gctctttcattatcatcaagacttagacatagaggcccagattggaacggtattttccaa
actaaagactcagttcttacccacgaacgtttagctattgttggtttagaaaacggtgct
caaccattattaaacgaagatgaaactattgcccttactgtcaacggtgaaatttataac
cacgaacaattaagagaagaattaattgccaccggtaaacacacattcaaaacccacagt
gattgtgaaccaattttacatctctatgaagataaaggtgatgattttgtacatttactc
aacggtgattttgcttttgttgtctatgattcaaaagctaacacttttttagctgctcgt
gatccaattggtgttgttccattatatattggttggagcaaagatggtgctgtttggttt
gcatcagaaatgaaagcattaaaagatgattgttatagattcgaagcttttccaccaggt
ttctattattcaagcaaaactaaagaatttgttagatattataaaccagattggattatg
ggtgctgagccacaaccaagcactgaagaacaagtacttccattaattaaagatgctttt
gaaaaagctgttgtctctagaatgatgagtgatgtcccatatggtgttttattatcaggt
ggtttagattcttcattagttgcaagtattgttagcagacacgccgaaaaaagaattgaa
gatcacgaacaatcacgtgcttggtggccaagaattcactcattctgtattggtttaaag
gatgccccagatcttaaagctgctcgtgaagttgctagcttccttggtactgttcaccac
gaatataactttaccgttcaagaaggtattgatgctctttctgatgttattaaacattta
gaaacctacgatgtcactacaattagagcttcaactccaatgtactttttatcaagaaaa
attaaagctatgggtgtaaagatggttttatcaggtgagggttcagatgaaatctttggt
ggttatttatacttccacaacgctccagatgccaatgaattccacagcgaatgtgttcgt
cgtattaaagctcttcattcattcgattgtcttagagccaacaaatcaactgctgcttgg
ggtgttgaagtacgtgttccattcttagatcaaggtttcctccaaactgctatgtctgtt
tcaccaactcataaagtttgtaccgatgctgaaggtaaaaagagaatggaaaaatacatt
ttaagaaaggcattcgaaagcaaggaaaaaccatatttaccagattcagttttatggcgt
caaaaagaacaattttcagatggtgttggttatagctggattgatggattaaaggaatat
gctgaatctgaaattacaaatgaagaatttgctaaaagggaaacttatttcccagatgat
accccagatactaaagaagctttcctctaccgtagattattcgaacaactcttcccagga
aaagaatgtagagaaactgttcaacattgggttccaaaatggagtacttctaccgatgcc
agtggtagagctcaaaaaatccatgatcaacataaagatatttaa

DBGET integrated database retrieval system