KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_154263Help
Entry
DICPUDRAFT_154263 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 831 aa AA seqDB search
MDTNENYPPNLYNKVNLLRFQKPVTTPPTTISSGSASSTPSSTGPTSSSSSSISRYSIIA
NSLSPQHNQQQQQHNQQEQEPYNESMEQTPSPPPPQQQKSTIKKSLTEWYQLIESEMIKF
RDPNNRAPEFIKYLTQIFQQACDNLEHKNSIEFTSILFNRAIFQSECGDDDDSKGTLKYM
KVLKMKRSDIYILLAKLEMKSFNFSKARSNINRAIQKKISPTKDLEDFLRVIDKEEEDFK
RNGGNNMNIYSTMENDQPMVINLQSSFNQQQQSQQPMSTPVHSNNFAPSNSSVLTNRNRI
STLPTPTSKLSIKPIGLTSQPLRVKNNSNLNNQSIVMMESDEMEDDTKPTKKDQEFENNE
SGDDDDDDDDDGNDSGEDDGEEYEEKQENQINPSFNHSNLSIKNNNNPTFIPTITPTASL
NNNQNNNQNNVLIDPQQRRSSIQNQRANKPPVIPPPSKIKQQQEQQQQKQLQQHEQQKQL
LQEQQKQLLQQQQQQQQQQQQQQEIQKQNQAQATTAQQKQKSIPQQQQQQQQQSFEENFD
KQKSFEIAKSWSEVAMVNNKPYLRIEFIGKGGSGKVYKVLSHDLKIYALKYVCLRSDQSE
IEAQLNEIEMLKRLRKRINIIQLIDYEVNISKAYILLVLEFGEIDLSKLLQRLQTPTNVN
FIRIYWQQMLQAVHTIHEEKIIHGDLKPANFVSVQGSLKLIDFGIAKAIQSDDTTNIIRD
SQIGTINYISPEALIDTSQGAGSKQCMKLGRASDIWSLGCILYEMAFGYPPFKNFSNMFM
KYQAIINPNHIIEFPKHPNENLVNVLKLCLKRNPQERPTIPKLLEHDFLKL
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaatgaaaactatccaccaaatttatataacaaagttaatttattaagattt
caaaaaccagtgacaacaccaccaacgacaatatcaagtggatctgcatcatccacacct
tcttctactggaccaacttcgtcttcatcatcatcaattagcagatactcaattatagca
aattcactatcaccacaacataaccaacagcaacaacaacacaaccaacaagagcaagaa
ccatacaatgaatcaatggagcaaacaccatcacctccgccaccacagcaacagaaatct
actattaaaaaatcattaacagaatggtatcaattaattgaaagtgaaatgattaaattt
agagatccaaacaatagagcaccggaatttatcaaatatcttactcaaattttccaacaa
gcatgtgataacctagaacataaaaactctatagaatttacttctattttatttaatcgt
gcaatatttcaaagtgaatgtggtgatgacgatgactcaaaaggaacattaaaatatatg
aaagttttaaaaatgaaaagatcagatatctacatattattggcaaaattagaaatgaaa
agttttaatttctcaaaggcaagatcaaatattaatcgagccattcaaaagaaaatatca
cccaccaaggatctagaggatttcttaagggtcattgataaagaagaggaggactttaaa
agaaatggtggtaataatatgaatatctatagtaccatggaaaatgaccaaccaatggta
attaatctccaatcctcatttaaccagcagcaacaatcacagcagccaatgagtacacca
gttcattcgaataactttgccccttccaattcatcagttttaacaaatagaaatagaatc
tctactttaccaacacccacatcaaagctatcaattaaaccaattggtttaacttcacaa
cccttaagagtaaaaaataattcaaatttaaacaatcaatcaatagttatgatggaaagt
gatgagatggaggatgataccaaaccaaccaaaaaagatcaagagtttgaaaataatgaa
agtggtgatgacgatgatgatgacgatgacgacggcaatgatagtggtgaagacgatggt
gaggagtatgaagaaaaacaagaaaatcaaataaatccatcatttaatcatagtaactta
tcaataaaaaataataataatccaacatttataccaactataacaccaacagcatcatta
aataataatcaaaacaacaaccaaaataatgtattaatagatccacaacaaagaagaagc
tcaatacaaaatcaaagagcaaataaaccaccagtaattcctccaccatcaaaaattaaa
caacaacaagaacaacagcaacaaaagcaattacaacaacatgaacaacaaaagcaacta
ttacaagaacaacaaaagcaattactccaacaacaacaacaacaacagcaacaacaacaa
caacaacaagaaatacaaaaacaaaatcaagcccaagcaacaacagctcaacaaaaacaa
aaatcaataccacagcaacaacagcaacaacagcaacaaagctttgaggaaaattttgat
aaacaaaaatcattcgaaattgctaaaagttggagtgaagttgcaatggtaaataataaa
ccgtatttaagaatcgaatttataggtaaaggtggtagtggtaaagtttataaagtttta
agccatgatttaaaaatttatgcattaaaatatgtttgtttaagatctgatcaaagtgaa
atcgaagcacaattaaatgaaatagaaatgttaaaaagattaagaaaaagaattaatatt
attcaactaatagattatgaagtgaacatttcaaaggcatatattttattggttttagaa
tttggagaaatcgatttatctaaacttttgcaaagacttcaaacaccaaccaatgttaat
ttcattcgtatttattggcaacaaatgttacaagcagtgcatacaattcacgaagaaaaa
attatccatggtgatttaaaaccagcaaattttgtatcggttcaaggaagtctaaagcta
attgattttggtatcgccaaagcaattcagtctgatgatactacaaatattattagagat
agtcaaattggtaccattaattatatctcaccagaagctctaatcgatacctctcaaggt
gctggctctaagcagtgtatgaagctaggtagggctagcgatatttggtctttaggttgc
attctctatgaaatggccttcggctatcctccattcaagaacttttcaaacatgtttatg
aagtaccaagcaattataaaccccaatcatataatcgaatttcctaaacatccaaatgaa
aatttagtaaatgttttaaaactttgtttaaagagaaatcctcaagaaagacccacaatt
ccaaaacttttagagcatgactttttaaaactttaa

DBGET integrated database retrieval system