KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_154455Help
Entry
DICPUDRAFT_154455 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 539 aa AA seqDB search
MLKKINNVGIIGGGVSGLSSYYYLRNGLYLSDNPNREIKINIYEKSNKLGGNIQTNIFNS
NNNNNNKTNNDTSNNNIVVEKGPRSLRAAGKGLNTLELVKRLGISNDIIFSSKKSNGKFL
LIDGKVQEVPMGSLFKIALFSLKYGLISAILKEPFQKIPKAVKERDPNYDESIFDFFSRR
LGKSVTQRFIEPFCLGIYAGDFKKLSIKSCFPAVCKVEPFNGLILGNIFTSAEEKAKYET
AKEKFEKSLIPTKLSLKEVLDKDIDKTGVFSFKENGLSQLIQKFRKNIESDGRTKLHFSS
TIKEISKTNSGAIKIIDESGAAQEFDRLITTIPFVELAPMFKESDPTLSKLLEAMNYSSI
AVVNFIYKSNEKVSNKIQDKGFGYLISSKENNPVIGVCFDSNTFPEFVNNNNNNSTANES
IITIMIGGNKGISERNDKWVDVTKSTSEELINIASKHLDKYLDIESKPDFTNVQIYNNGI
PHYEVGHQKLIDEINKHIYSNYSNTLLLGGNSLEGVGINDAIFKSKTLIHSLGLYKKVK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaataaataatgttggtattattggtggaggtgtgtcaggtttatcaagc
tattattatttaagaaatggtttatatttatcagacaatccaaatagagaaataaaaata
aatatttatgaaaaatccaataaactaggaggtaatatccaaaccaatatattcaatagc
aataataataataataataaaaccaataatgacacaagcaataataatattgttgttgaa
aagggtccaagatcattaagagctgcaggtaaaggtttaaatacactagagttggtcaaa
cgtttaggtatatcaaacgatattatattcagcagtaaaaaaagtaatggtaaattttta
ttaattgatggaaaggttcaagaggtaccaatgggatcattgttcaagatagcactattc
tcgttaaaatatggtcttattagtgcaattttaaaagagccattccaaaagataccaaaa
gcagttaaagaaagagatccaaattatgatgagtcgatatttgatttcttttcaagaaga
ttgggaaaaagtgttacacagagatttatagagccattttgtttaggtatttatgctggt
gactttaagaagctttcaattaaatcatgtttcccagcagtttgcaaagttgagccattc
aatggtcttatccttggtaacattttcacatcagctgaagaaaaagcaaaatacgaaact
gcaaaagaaaagtttgaaaaatcattgatcccaacaaaactttcgctcaaagaggtcctc
gataaagatatcgataaaactggtgttttttcgttcaaggagaatggtttatcgcaatta
attcaaaagtttagaaaaaatattgaaagtgatggtcgtaccaaactacacttctctagt
actattaaggaaatttcaaagaccaatagcggtgccatcaaaattatagatgaatctggt
gcagcccaagaatttgatagattaattactacaattccatttgtcgaacttgcaccaatg
tttaaagaatctgaccccactctttcaaaacttttagaggccatgaattattcctcaatt
gcagttgttaattttatttataaatcaaatgaaaaagtttcaaataaaattcaagataaa
ggttttggttatttaatatcatcaaaagaaaataaccctgttattggtgtttgttttgac
tcaaatacttttccagaatttgtaaataacaataataacaatagtactgcaaatgaatca
attatcactataatgattggcggtaataaaggaatctctgaaagaaacgataaatgggta
gatgtcaccaaatcaacatctgaagagttaatcaatatagcatcaaaacatttagataaa
tatttagatatagaaagtaaaccagactttacaaatgttcaaatctacaataatggtata
cctcattacgaagttggtcatcaaaaattaatagacgaaattaataagcacatatactct
aattattcaaatactcttcttttaggtggaaattcattagaaggtgtcggtatcaatgat
gcaatttttaaatcaaaaaccttaattcattcattaggtttatataaaaaagttaaataa

DBGET integrated database retrieval system