KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_154535Help
Entry
DICPUDRAFT_154535 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00062  Fatty acid elongation
dpp01100  Metabolic pathways
dpp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    DICPUDRAFT_154535
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DICPUDRAFT_154535
Lipid biosynthesis proteins [BR:dpp01004]
 Fatty acid synthase
  Component type
   DICPUDRAFT_154535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Lipase_2 Abhydrolase_1 DUF676
Motif
Other DBs
NCBI-GeneID: 10504412
NCBI-ProteinID: XP_003290057
JGI: Dicpu1_154535
UniProt: F0ZRL1
Position
Unknown
AA seq 288 aa AA seqDB search
MRFLAVFLILLSVASIISAYRPVVLMHGVTTGSSAMNNLEKWIQEALPGIYVKNVEIGNG
KLDSIFMDMNQQVEEFKNVVQSDPNLANGFNVIGFSQGTLISRAFIERFNEPKVNNYIGW
NGPQAGQFGTPFVNIQWVDKLLTTLTYSDHVQDNIAPAEYWKNPFKIPEYLEKSIFLADI
NNEGEAKNQTYKDNISSLSNMILSYSINDKTIVPKESGWFGFYADGNTDNIVPLQQQDQY
TQDWLGLRTLDESGRLHFFTTDCTHKDHPIEDYCKIYFTNYTLPWLQN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttagcagtttttttaattttattgtcagtcgcatcaattatttcagcttat
agaccagttgttttaatgcatggcgtcaccacaggcagttcagcaatgaacaatttagaa
aagtggattcaagaagctctcccaggaatttatgtcaaaaatgtcgaaattggcaacggt
aaattagattcaatctttatggatatgaaccaacaagttgaagaatttaaaaatgtagtt
caatcagatccaaatttagcaaatggttttaacgttattggtttctcacaaggtacttta
atttctcgtgcattcattgaacgtttcaatgaaccaaaagttaacaattatatcggttgg
aacggtccacaagctggtcaattcggtactccatttgtcaacatccaatgggtcgataaa
ttattaaccactttaacctattcagatcatgtccaagataacattgctccagctgaatat
tggaaaaacccattcaaaatcccagagtatttagaaaaatcaatctttttagctgatatc
aacaatgagggtgaagctaaaaaccaaacctacaaagataacatcagcagtttaagtaac
atgattctttcatacagtatcaacgataaaactattgttccaaaagaaagtggttggttt
ggtttctatgccgacggtaacactgacaacattgttccattacaacaacaagatcaatac
acccaagattggttaggtctcagaactcttgatgagtctggtcgtctccactttttcacc
actgactgtactcataaagatcacccaattgaagattattgtaaaatttattttaccaat
tacactttaccatggttacaaaattaa

DBGET integrated database retrieval system