KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_154735Help
Entry
DICPUDRAFT_154735 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DICPUDRAFT_154735
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     DICPUDRAFT_154735
Ubiquitin system [BR:dpp04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     DICPUDRAFT_154735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 874 aa AA seqDB search
MEEILLSSIDESLNCGLFKNAMFLTERLYALSPSEDNLFKMAQLYYNMGKANQCLLLLQS
KQLTMIKNLYLLALSNYDLGNIQESEISISKCCVYFEKYYKRLNTTTAALNEGNNNNNSN
SNSNKTSSGSGGIKDDFDLYDFYDFSQSSNDEINSLSFGFDSPASIASIYYLMGMVSKKK
NQKEKSIKYLKKSVQTYPFLWLAFEQLCNICPDEINVDDFFTQNNTLPININNNSNNNNI
TINVNNDNDIIDENKQNPQNTNINYNQQQQQQQQPVLRMPQFKSNVGLTPSSFYDSSSIH
ITPINFKASIQQHQQQHQQQTNQKYSNKYFITPQTPLSHITPILSNRYSKNHVEPIPMVM
DTPDAKSSIHAHSTPSPGVHHSKHQHHTGYIPPPPVKKFDPISTPISMEKRKPLFGNISS
HESTKTSVTTTSNKIESTPITSISNKKKHVNFGKTEQFNIKDLSSDEEDDITTTTKNTTT
TKNLQQRIIEEAEQDPYEQDQLNISKPDFYEFDESSILDFNDTDIYENLIELHKGQTQLL
ELFHILGESVRLLSLYLCKESIESFKRLSIEQYNTGFVLTKVARAYHELIDYKTCRTIFQ
DLSLMEPYRLEGIELYSTLLWQMKEETELSYIAHKFSEFDRLSPYTWIVVGNCFSLQKDH
ESAIKLFRRSVQLDPTFTYAYTLCGHEYLANDELELALNAFRMAIRCDSRHYNAHYGIGL
VYYRQEKYNLAEYHFRKALSINPFSSVLSCYLGMTLQHNPQKIPEGIEYLYRSIKLQPKN
TFAKFKLAAYLYANQQFYEAIDQLLEFKELEPRETPIYILLGKCYKRLGDLNKALEYLNT
ALDLDPKNSNYIRSTIDKLHVKDDNENEDYFQLN
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattttactatcatcaattgatgaatcacttaattgtggtttatttaaaaat
gcaatgtttttaacagaaagattatatgcattatcaccaagtgaagataatttatttaaa
atggcacagttgtattataacatgggaaaggcaaatcaatgtttattactattacaaagc
aagcaattaacaatgataaagaatttatatttgttagcattatcaaattatgatttggga
aatatccaagagtctgaaatttcaatttcaaaatgttgtgtatactttgaaaaatattat
aaaagattaaatacgacaactgcagcattaaacgaaggtaataataataataacagcaac
agcaacagtaataaaacaagttctggtagtggtggtataaaagacgatttcgacttgtat
gacttttatgacttttcacaatcttcaaatgatgaaattaatagtctttcgtttggtttc
gattcaccagcaagtatagcgtcaatttattatcttatgggtatggttagcaagaaaaaa
aatcaaaaagagaaatcaattaaatatttaaaaaagagtgttcaaacttatccattcttg
tggttagcattcgaacaactatgtaatatatgtcctgatgagattaatgtagatgatttt
tttacccaaaataatacattaccaattaatataaataataatagtaataataataatata
accattaatgtcaataatgataatgatataatcgatgaaaataaacaaaaccctcaaaac
accaatataaactataatcaacaacaacaacaacaacaacaaccagtccttagaatgcca
caatttaaatcgaatgtaggcttaacaccatcttcattttatgattcatcctcaattcat
attactcccattaattttaaggcatcaattcaacaacaccaacaacagcaccaacaacaa
accaatcagaaatattcaaataaatatttcattacaccacaaaccccactttcacacata
acaccaattttatcaaatagatattctaaaaatcatgttgaaccaataccgatggtaatg
gatacaccagatgccaaaagctcaattcatgcacactccacaccatcaccaggtgtacat
cattctaaacaccaacatcatactggctatatcccacctccaccagttaaaaaatttgat
ccaattagtacaccaatatcaatggaaaaaagaaagcctctatttggaaatatttcatca
cacgaatcaaccaagacatctgtaacaacaacatcaaataaaattgaatccacaccaata
acatcaatctctaataaaaagaaacatgttaattttggtaaaaccgaacaatttaatatc
aaagatttatccagcgatgaggaagatgatattaccaccacaaccaaaaacaccacaact
acaaaaaatttacaacaacgtatcattgaagaagcagaacaagatccatacgaacaagat
caattaaatatctcaaaaccagatttttatgaatttgatgaatcctcaattttagatttt
aacgatacagatatttacgaaaatttaattgagttgcataaaggacaaacccaattatta
gaactgttccatatattaggtgaatcagttagattactttcattgtatttatgtaaagaa
tcaattgagtcatttaaaagactttcgattgaacaatataatacaggttttgtactaacc
aaagttgcaagagcatatcacgaattaatcgactataagacatgcagaaccatattccaa
gatctatcattaatggaaccatatcgtttagaaggtatagaactctattcaactctatta
tggcaaatgaaagaagaaacagaattaagctatatagcacacaaattttcagaatttgat
agactctcaccatacacttggattgttgtaggcaattgtttcagtttacaaaaagatcac
gaaagtgcaattaaactatttagaagatctgtacaattggatccaacctttacatatgcc
tatacactctgcggacatgaatatttagcaaacgatgaattagaattggcactaaatgca
ttcagaatggcaattagatgtgactcaaggcattacaacgctcactacggtattggttta
gtatattatcgtcaagaaaagtataatcttgcagaatatcactttagaaaagcactatcc
attaatccattttcatccgttttatcatgttacctcggtatgacattacaacacaaccct
caaaagataccagaaggaattgaatatttgtatagatccataaaacttcaaccaaagaat
acatttgccaaatttaaattagctgcctatctttacgcaaatcaacaattctatgaagca
atcgatcaacttttagaatttaaagaacttgaaccaagagaaactccaatctatatctta
ctgggaaaatgttataaacgtttgggtgatctaaataaagctttagaatatttgaacact
gctttagatctcgatcctaaaaattcaaactatattcgttcaactattgacaagctacat
gtaaaagatgataatgaaaacgaggattatttccaattaaattaa

DBGET integrated database retrieval system