KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_15497Help
Entry
DICPUDRAFT_15497  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DICPUDRAFT_15497
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DICPUDRAFT_15497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 810 aa AA seqDB search
IDKIKNNKAKSLKKKQQQQQQQQQQQQRNNTEQPKKSNNSLINNINNIKNNINDKEINNQ
HQQQQKQQDSEENELIKKKKLFESVISNEAKPLFNRNIKFKEAEIQEDNQLKLKYKPINN
INAVTTASKKLLELKQKQQQQKKQELDEEDDDNVLAKPKKVIFKPEELHPLMKWRSITKI
GAGLNNIGNTCFMNSVLQCLTYSPTLANYMISREHSKNCTNKSFCIFCSLEEHIIASHKA
TGRSITPKEIAANIRKVAPTFRIGRQEDSHEFIRFVIESLQKVCLSKFPKGSISHRDSMT
TVIGSIFGGYLRSQVKCSVCQYESNTFDPFMDLCVDINQADSLTKGLQNFVKSEILDGSN
RYKCSKCKKLVKAAKRLQIHISPPILTVQIKRFSFLGSYGGKVNKHIQFEQTLNLSPYMT
QANDHSIYDLYAVLVHLGGSTNSGHYYCYVKGTNGIWYNMDDSMVSQVSLQTVLGSKAYM
LFYSKRDTERSINTNTVIPRNIVGQKRKLDEEKSPVLNGSKPTNTATSSVKVEPAPAPIK
KSPVLNGTKTATTTSEPKKTSPVLNGAKSSSIASSAAAPEIKKSPLLNGAKSASPPLKSF
SLGGDDEPLSQRPDDSDDESDNYDDSSLSSLSPPSSESESSNSDNSNNNSPSLKPSSILE
KILKSQPATKQQQQKELEWDKPRYAEEDEQLKKLNDKKKLKSINNAKQLKENSKVKEENQ
FHFNVGKWDDDDVNPEFKEAQKELLKDEQIKELVHEKDEHNKHFDQGRVKKVKVKKSLNP
DSVNQFSIQTQKLKQHKENQLKFGDNYNIK
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atagataaaattaaaaataataaagctaaatcattaaaaaaaaaacaacaacaacaacag
caacaacaacaacaacaacaaagaaataatacagagcaaccaaaaaagagcaataatagt
ttaattaataatataaataacattaaaaataatataaatgataaagaaataaataaccaa
catcaacaacaacaaaaacaacaagatagtgaagaaaatgaattaataaaaaaaaagaaa
ttatttgaatcggttatttcaaatgaagcaaaaccattatttaatagaaatattaagttt
aaagaagcagagattcaagaggataatcaattaaaattaaaatataaaccaataaataat
ataaatgcagttacaacagcctccaaaaaattattagaacttaaacaaaagcaacaacaa
caaaagaaacaagaattggatgaagaggatgacgacaatgtcttagcaaaaccaaaaaaa
gttatattcaaaccagaggaattacacccattaatgaaatggagatcaattacaaagatt
ggagcaggtttaaataatatcggtaatacatgttttatgaattcagttctccaatgcctc
acctattcaccaacattagcaaactatatgatctcacgtgaacatagcaaaaactgcact
aataaaagtttctgcattttctgttcattagaagagcatattattgcaagtcacaaggca
accggtagatccataactccaaaagaaattgcagcaaatataagaaaggttgcaccaaca
tttagaattggtcgtcaagaagattcccacgagtttattcgtttcgtaatcgaatctctt
caaaaagtttgtctttccaagttcccaaaaggctcaataagtcatcgtgattcaatgact
acagtaattggttcaatttttggtggttatcttagaagtcaagttaagtgctcagtttgc
caatatgaatcaaatacattcgacccatttatggatttatgtgtagatatcaatcaggca
gattctttaactaaaggacttcaaaactttgttaaatccgaaattctcgacggttcaaat
cgttataaatgttcaaaatgtaaaaagctggttaaggcagcaaaacgtttacaaattcat
atctctccaccaattttaactgtccaaattaaacgtttctcatttttaggttcatatggt
ggtaaagttaataaacatattcaatttgaacaaaccttaaacctttcaccatatatgaca
caggcaaatgatcattcaatctacgatttatatgctgtattggttcatttaggtggcagc
acaaattcaggtcattattattgttatgttaaaggtacaaatggaatttggtataatatg
gatgattcaatggtttcacaagttagtttacaaactgttttaggttcaaaggcctatatg
ttattctattcaaagagagatactgaaagatccattaacacaaacacagttatcccaaga
aatatagttggccaaaagagaaaattagatgaagagaaatcaccagtattaaatggttct
aaaccaaccaacacagctacatcatcagtaaaagttgaaccagcaccagccccaattaaa
aaatcaccagtattaaatggtaccaaaacagctaccacaacatcagaaccaaagaaaaca
tcaccagtattaaatggtgctaaatcatcatcaattgcatcatcagcagctgcaccagaa
atcaaaaaatcaccattattaaacggtgctaaatcagcttcaccaccattaaagtcattc
tctcttggtggtgacgatgaaccattatcacaaagaccagacgacagcgacgatgaaagt
gacaactatgacgactcttcattatcatctttatcaccaccatcctcagaatcagaatct
agcaacagtgacaatagtaataataattcaccatcattaaaaccatcctcaattttagaa
aaaatattaaaatcacaaccagccaccaaacaacaacaacaaaaagaattagaatgggat
aaaccaagatacgccgaggaagacgaacaattaaaaaaattaaatgataaaaagaaatta
aaatcaattaacaatgctaaacaattaaaagaaaattcaaaagttaaagaagaaaaccaa
ttccacttcaatgtcggtaaatgggacgatgatgatgttaatccagaatttaaagaagct
caaaaagaactcttaaaggatgaacaaataaaagagttagttcacgaaaaagatgaacac
aataaacatttcgatcaaggtagagttaaaaaagttaaagtaaagaaatcacttaatcca
gactctgtaaaccaatttagcattcaaactcaaaaattaaaacaacataaagaaaatcaa
ttaaaatttggagataattataatataaaa

DBGET integrated database retrieval system