KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_157031Help
Entry
DICPUDRAFT_157031 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dpp01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dpp00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 308 aa AA seqDB search
MNQKNNSILLILGTIFIIFNININYVNSTPSTYKPVILMHGFALSNKCGTYQDWNHYLEF
IKKYNPGQIAVSLNVDNGFKSAKTMFKQVNDVYQAINDIVQHNNAFDNGFHVIGHSQGAL
TLRSITEIYGLNIDNFVSLAGVHMGIYGVGFTNNYWFGNFTDKELTNLLYTKTFQKDFSV
ANWWTDIDHERYLRDNMFLPIINQELEEKIPNYKENFINSISGSFNAFGSPQDGIVVPWI
SELFGSYDSNLNMVPMEESIVFKNDTFGLQTLANQGKLNLTTVEGVKHAEWLSREDLFVK
YVLPLISK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaaataattcaatattgttaatattggggactatttttataatttttaat
attaatataaattatgtgaattcaacaccatcaacttataaaccagttattttaatgcat
ggttttgcattaagcaataaatgtggtacttatcaagattggaaccattatttagaattt
attaaaaaatataacccaggccaaattgctgtttctttaaatgttgataatggatttaaa
tcagccaaaacaatgtttaagcaagttaatgatgtttatcaagctattaacgacatcgtt
caacataataatgctttcgataatgggttccatgttatcggtcattcacaaggtgcatta
actttaagatcaattaccgaaatctatggtttaaatattgataatttcgtatctttagct
ggtgttcatatgggaatttatggtgtaggatttacaaataactattggtttggtaatttt
acagataaggaattaaccaaccttttatacacaaagacattccaaaaggatttctcagtt
gccaattggtggaccgatattgaccacgaaagatatcttcgtgataacatgtttttacca
attatcaatcaagagttagaagaaaagatcccaaattacaaagaaaatttcattaatagt
atttcaggttcattcaatgcttttggttcaccacaagatggtattgtagtaccatggatt
tcagaattatttggttcttatgattcaaatttaaatatggttccaatggaagaatcaatt
gtttttaaaaatgatacttttggattacaaactttagccaatcaaggtaaattaaattta
acaactgtcgaaggtgttaagcatgctgaatggctttcaagagaggatttattcgttaaa
tatgtattaccattaatttccaaataa

DBGET integrated database retrieval system