KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_157425Help
Entry
DICPUDRAFT_157425 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DICPUDRAFT_157425
  Lipid metabolism
   00062 Fatty acid elongation
    DICPUDRAFT_157425
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DICPUDRAFT_157425
Lipid biosynthesis proteins [BR:dpp01004]
 Fatty acid synthase
  Component type
   DICPUDRAFT_157425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 308 aa AA seqDB search
MLNKKLTLSIILFIFSFINYSLSASSSDATPIRNIVIWHGLGDSCCFPFSMGKIKDIIQN
QYPGVYVKSIEIGSSIDEDVYNSWFKNVNEQIDMACEMIKADTNLTNGFNAVGFSQGSLF
LRAFVERCNDPPVHNLISIGGPQNGVFGAPRCATTNGTFCNVARNLLELGAYDEYVQNNL
VPAEYWQDPLQYSKFLEKSIFLADINNMKDVKNQTYKDNLLSLNKFALTLFLNDTIVIPR
ESEHFGWYEEGQAKNIIPMEKTQLYQEDWIGIQQLDNEGKLIFLESPGNHLQFTEQWFIE
NIIPLLNE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataaaaaactaacattatcaattattttatttattttttcttttataaattat
tcattgtcagcatcatcgagcgatgccacaccaataagaaatattgttatatggcatggt
ttaggagactcttgttgttttccatttagtatgggtaaaataaaagacattattcaaaac
caatacccaggtgtttatgtcaaaagtattgaaattggatccagtattgatgaagatgtt
tacaactcatggttcaaaaacgtcaatgagcaaatcgatatggcttgcgaaatgatcaag
gccgataccaacttaacaaatggatttaatgctgttggattcagtcaaggtagtctcttt
ttaagagcatttgtagagagatgtaatgatccaccagtacataatttaattagtattggt
gggccacaaaacggtgtttttggtgccccaagatgtgcaacaacaaatggtactttttgt
aatgtagctagaaatcttttagaacttggtgcctatgatgaatatgtacaaaataacttg
gtacctgcagaatactggcaagatccattacaatactcaaagtttttggaaaaatctata
tttttagcagatatcaataatatgaaagatgtaaaaaatcaaacctataaagataatctt
ttgtcattaaataaatttgcattaacattattcctcaatgacaccattgtaattccaaga
gaaagtgaacatttcgggtggtatgaagaaggtcaagcaaagaatattataccaatggaa
aaaacccaactttaccaagaagattggattggcattcaacaactagacaacgaaggtaaa
ttaatatttttggaatcaccaggaaatcatttacaattcaccgagcaatggtttatcgaa
aatattataccattattaaatgaataa

DBGET integrated database retrieval system